DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and Tfam

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_033386.1 Gene:Tfam / 21780 MGIID:107810 Length:243 Species:Mus musculus


Alignment Length:197 Identity:61/197 - (30%)
Similarity:103/197 - (52%) Gaps:25/197 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 PKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLSKNWSDADAQLKERLQAEFKRDQQIYVEER 142
            ||||::.|.||..||.||.||.:|.....|:||:::..|.:.....|:..:|:||.:.:.|.|..
Mouse    49 PKKPMSSYLRFSTEQLPKFKAKHPDAKLSELVRKIAALWRELPEAEKKVYEADFKAEWKAYKEAV 113

  Fly   143 TKYDATLTEEQRAEIKQLKQDLVDAKERRQLRKR--VKE-----LGRPKKPASAFLRFIASE--- 197
            :||...||..|...:::      :|::|| |:|:  ||.     ||:||:|.||:..:::..   
Mouse   114 SKYKEQLTPSQLMGMEK------EARQRR-LKKKALVKRRELILLGKPKRPRSAYNIYVSESFQE 171

  Fly   198 -RINTPQGDKQTYREWHQKTTAKWTRLSDSEKEVYMQESRKEMELYRKAISVWEEKMIRLGHIDV 261
             :.::.||..:...|       .|..||..||:.|:|.::.:...|...:..|||:|..:|..|:
Mouse   172 AKDDSAQGKLKLVNE-------AWKNLSPEEKQAYIQLAKDDRIRYDNEMKSWEEQMAEVGRSDL 229

  Fly   262 VR 263
            :|
Mouse   230 IR 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 24/63 (38%)
HMGB-UBF_HMG-box 183..247 CDD:238686 16/67 (24%)
TfamNP_033386.1 HMG_box 49..116 CDD:278906 24/66 (36%)
HMGB-UBF_HMG-box 154..215 CDD:238686 16/67 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31139
Inparanoid 1 1.050 96 1.000 Inparanoid score I5039
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49431
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 1 1.000 - - FOG0007031
OrthoInspector 1 1.000 - - oto92499
orthoMCL 1 0.900 - - OOG6_107571
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R14311
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.870

Return to query results.
Submit another query.