DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and B0238.11

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_504410.1 Gene:B0238.11 / 178915 WormBaseID:WBGene00015075 Length:317 Species:Caenorhabditis elegans


Alignment Length:202 Identity:46/202 - (22%)
Similarity:76/202 - (37%) Gaps:42/202 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 AAASISNTPAVPSKTLEEQLGLPPRPKKPLTPYFRFMREQ--------RPKLKAANPQITTVEVV 109
            :.|:|| |.....|:|.|...:|.||...:..|.:  :.|        .|...|........|..
 Worm   142 SCAAIS-TYLNSEKSLVEYKSMPDRPPTKIQLYIK--KHQIMLKGIGGEPMKNAYKAMNADTEGA 203

  Fly   110 RQLSKNWSDADAQLKERLQAEFKRDQQIYVEERTKYDATLTEEQRAEIKQLKQDLVDAKERRQLR 174
            ::|.:...:|..|...:||            |.......|||||:..|....:.|......:::.
 Worm   204 KELDELLREASLQYIPQLQ------------EFLDTHPNLTEEQKRSIVNKMKMLNKKYNSKEIS 256

  Fly   175 KRVKELGRPKKPASAFLRFIASERINTPQGDKQTYREWHQKTTAKWTRLSDSEKEVYMQESRKEM 239
            ...|:....|.|.:||..|..:      :.||  ||:           |||.|:|:.:|:..:::
 Worm   257 STPKKRSSKKDPETAFSLFCRT------KNDK--YRD-----------LSDEEREIKLQKKFEKL 302

  Fly   240 ELYRKAI 246
            ...:|.|
 Worm   303 PAAQKDI 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 11/71 (15%)
HMGB-UBF_HMG-box 183..247 CDD:238686 17/64 (27%)
B0238.11NP_504410.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.