DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and hmg-5

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_501245.1 Gene:hmg-5 / 177543 WormBaseID:WBGene00001975 Length:204 Species:Caenorhabditis elegans


Alignment Length:216 Identity:58/216 - (26%)
Similarity:89/216 - (41%) Gaps:51/216 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 PRPLAAASISNTPAVPSKTLEEQLGLPPRPKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLS 113
            ||...|||   ||.||       ||:      .:.||..|::|   ..||....:...:::::||
 Worm    17 PRASVAAS---TPQVP-------LGM------NINPYAMFIKE---NFKANTSDMKRTDLMKELS 62

  Fly   114 KNWSDADAQLKERLQAEFKRDQQIYVEERTKYDA--------TLTEEQRAEIKQLKQDLVD---- 166
            ..|.......|::           |.|....|:|        ..||||:..:...|:...:    
 Worm    63 GKWKALSISEKDK-----------YTELSKNYNAQKLDDFMKLSTEEQKKLVDSAKEKKAERASR 116

  Fly   167 --AKERRQLRKRVKELGRPKKPASAFLRFIASERINTPQGDKQTYREWHQKTTAKWTRLSDSEKE 229
              |||||:.|   |:.|||..|.||:..||..:........|:..:|    ..|:|...:||:|:
 Worm   117 RHAKERREKR---KQSGRPSVPPSAYALFIKEKLSGAGMESKEKMKE----AVAQWKAFTDSQKK 174

  Fly   230 VYMQESRKEMELYRKAISVWE 250
            .|..|::|..:.|...:..||
 Worm   175 KYTDEAKKLKDEYHVVLQKWE 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 12/63 (19%)
HMGB-UBF_HMG-box 183..247 CDD:238686 17/63 (27%)
hmg-5NP_501245.1 NHP6B <37..187 CDD:227935 43/170 (25%)
HMGB-UBF_HMG-box 132..192 CDD:238686 17/63 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 63 1.000 Inparanoid score I3979
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49431
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007031
OrthoInspector 1 1.000 - - oto18509
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R14311
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.000

Return to query results.
Submit another query.