DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and hmg-1.2

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001380090.1 Gene:hmg-1.2 / 175890 WormBaseID:WBGene00001972 Length:235 Species:Caenorhabditis elegans


Alignment Length:226 Identity:47/226 - (20%)
Similarity:92/226 - (40%) Gaps:49/226 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 PAVPSKTLEEQLGLPPRP-------------KKPL----TPYFRFMR----EQRPKLKAANPQIT 104
            |:..|.||.:...|.|.|             |.|:    :||..|::    |.:.|....|.|:|
 Worm    11 PSSSSPTLYQSHQLQPNPSATMYQATPRDMGKPPVRGKTSPYGFFVKMCYEEHKKKYPNENVQVT 75

  Fly   105 TVEVVRQLSKNWSDADAQLKERLQAEFKRDQQIYVEERTKYDATLTEEQRAEIKQLKQDLVDAKE 169
              |:.::.|:.|       |..:..|.:|..::..::..:|        :||:........||..
 Worm    76 --EISKKCSEKW-------KTMVDDEKRRFYELAQKDAERY--------QAEVSVAAYGGEDAMR 123

  Fly   170 RRQLRKRVKELGRPKKPASAFLRFIASERINTPQGDKQTYREWH-----QKTTAKWTRLSDSEKE 229
            :|:..|  |:...||:..|||..:...:|.....|    :.:|.     |:....|..:....|:
 Worm   124 KRKRAK--KDPHAPKRALSAFFFYSQDKRPEIQAG----HPDWKVGQVAQELGKMWKLVPQETKD 182

  Fly   230 VYMQESRKEMELYRKAISVWEEKMIRLGHID 260
            :|.|:::.:.:.|...:..::.:|.::..:|
 Worm   183 MYEQKAQADKDRYADEMRNYKAEMQKMSGMD 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 17/84 (20%)
HMGB-UBF_HMG-box 183..247 CDD:238686 14/68 (21%)
hmg-1.2NP_001380090.1 HMGB-UBF_HMG-box 50..112 CDD:238686 17/78 (22%)
HMGB-UBF_HMG-box 135..200 CDD:238686 14/68 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.