DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and hmg-1.1

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001370073.1 Gene:hmg-1.1 / 175081 WormBaseID:WBGene00001971 Length:95 Species:Caenorhabditis elegans


Alignment Length:82 Identity:15/82 - (18%)
Similarity:40/82 - (48%) Gaps:11/82 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 PPRPKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLSKNWSDADAQLKERLQAEFKRDQQIYV 139
            |..||:.::.:|.:|:|.|.::|  .|.:...:|.:.....|    .:|.::.:.|.|.     .
 Worm    25 PNAPKRAMSAFFFWMQENRERIK--KPGMGVADVAKAAGVEW----GKLTDKSRWEKKA-----A 78

  Fly   140 EERTKYDATLTEEQRAE 156
            :::.:|:..:...::::
 Worm    79 DDKKRYEVDIANYKKSQ 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 13/63 (21%)
HMGB-UBF_HMG-box 183..247 CDD:238686
hmg-1.1NP_001370073.1 HMGB-UBF_HMG-box 28..89 CDD:238686 14/71 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.