DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and Hmg20b

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_006513311.1 Gene:Hmg20b / 15353 MGIID:1341190 Length:415 Species:Mus musculus


Alignment Length:215 Identity:46/215 - (21%)
Similarity:87/215 - (40%) Gaps:61/215 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LPPRPKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLSKNWSDADAQLKERLQAEFKRDQQIY 138
            ||..||.|:|.|.||:.|:|.:::..:|.:...|:.:.|...||......|:|...|.::::|.|
Mouse    66 LPNGPKAPVTGYVRFLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPAEKQRYLDEAEKEKQQY 130

  Fly   139 VEERTKYDAT-----LTEE-QRAEIKQ------------------------------LKQDLVDA 167
            ::|...|..:     .||: |..:||:                              ..::.:| 
Mouse   131 LKELWAYQQSEAYKVCTEKIQENKIKKEDSSSGLMNTLLNGHKGVDCDGFSTFDVPIFTEEFLD- 194

  Fly   168 KERRQLRKRVKELGRPKKPASAFLRFIASERINTPQGDKQTYREWHQKTTAKWTRLSDSEKEVYM 232
                |.:.|..||.|.:|...||            :......:...|..::...||   |:|:.:
Mouse   195 ----QNKAREAELRRLRKMNVAF------------EEQNAVLQRHTQSMSSARERL---EQELAL 240

  Fly   233 QESR-----KEMELYRKAIS 247
            :|.|     ::::..|:|::
Mouse   241 EERRTLALQQQLQAVRQALT 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 19/63 (30%)
HMGB-UBF_HMG-box 183..247 CDD:238686 12/68 (18%)
Hmg20bXP_006513311.1 HMGB-UBF_HMG-box 70..134 CDD:238686 19/63 (30%)
OmpH 190..>254 CDD:214922 16/83 (19%)
FAM222A <314..>400 CDD:373691
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.