Sequence 1: | NP_732527.1 | Gene: | TFAM / 42433 | FlyBaseID: | FBgn0038805 | Length: | 284 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006513311.1 | Gene: | Hmg20b / 15353 | MGIID: | 1341190 | Length: | 415 | Species: | Mus musculus |
Alignment Length: | 215 | Identity: | 46/215 - (21%) |
---|---|---|---|
Similarity: | 87/215 - (40%) | Gaps: | 61/215 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 74 LPPRPKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLSKNWSDADAQLKERLQAEFKRDQQIY 138
Fly 139 VEERTKYDAT-----LTEE-QRAEIKQ------------------------------LKQDLVDA 167
Fly 168 KERRQLRKRVKELGRPKKPASAFLRFIASERINTPQGDKQTYREWHQKTTAKWTRLSDSEKEVYM 232
Fly 233 QESR-----KEMELYRKAIS 247 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
TFAM | NP_732527.1 | HMGB-UBF_HMG-box | 78..142 | CDD:238686 | 19/63 (30%) |
HMGB-UBF_HMG-box | 183..247 | CDD:238686 | 12/68 (18%) | ||
Hmg20b | XP_006513311.1 | HMGB-UBF_HMG-box | 70..134 | CDD:238686 | 19/63 (30%) |
OmpH | 190..>254 | CDD:214922 | 16/83 (19%) | ||
FAM222A | <314..>400 | CDD:373691 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5648 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |