DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and AgaP_AGAP004791

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_318023.4 Gene:AgaP_AGAP004791 / 1278434 VectorBaseID:AGAP004791 Length:324 Species:Anopheles gambiae


Alignment Length:245 Identity:61/245 - (24%)
Similarity:108/245 - (44%) Gaps:48/245 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 PSRANDTDHRPLTPPRPLAAASISNTPAVPS--KTLEEQLGLPPR----PKKPLTPYFRFMREQR 93
            |:.|...:.:  .|....|:.|.|.|....|  ||.:::....|:    ||.|||.|.|:|.|.|
Mosquito    27 PTDAGKNEGK--APETSNASPSGSGTKGKQSAPKTTKKKRQKAPKDANAPKHPLTGYVRYMNEHR 89

  Fly    94 PKLKAANPQITTVEVVRQLSKNWSDADAQLKERLQAEFKRDQQIYVEERTKYDATLTEEQRAEIK 158
            ..::..:|.:|.:||.:.:::.||....:.|:......:.|::.|.:|.::|  .|..|.:|  |
Mosquito    90 EGVRQKHPNLTPIEVTKIMAEEWSKLSEERKKPYLEAAEVDKERYNKEISEY--KLNNEAKA--K 150

  Fly   159 QLKQDLVDAKERRQLRKRVKELGRPKKPASA--FLRFIASERINTPQGD------KQTYREWHQK 215
            .|:.:...||         ||:..||...|:  ::.....::: ..|||      .:.:.: |.|
Mosquito   151 ALQNESQVAK---------KEVTGPKVVISSIPYVNGKVEQKV-ARQGDYDIPIFTEDFLD-HNK 204

  Fly   216 TTAKWTRLSDSEKEVYMQESRKEMELYRKAISVWEEKMIRLGHIDVVRHG 265
            |.       |||    ::..||....|.:..||.|:      |::.:.:|
Mosquito   205 TI-------DSE----LRTLRKSNIDYEQQNSVLEK------HVENMENG 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 19/63 (30%)
HMGB-UBF_HMG-box 183..247 CDD:238686 15/71 (21%)
AgaP_AGAP004791XP_318023.4 HMGB-UBF_HMG-box 74..139 CDD:238686 20/64 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.