DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and AgaP_AGAP000281

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_310839.5 Gene:AgaP_AGAP000281 / 1271977 VectorBaseID:AGAP000281 Length:463 Species:Anopheles gambiae


Alignment Length:192 Identity:38/192 - (19%)
Similarity:87/192 - (45%) Gaps:16/192 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 AAASISNTPAVPSKTLEEQLGLPPRPKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLSKNWS 117
            |||:.:..|.|..|..:..   |..|:||::.|..|.|:.:..:|..||..:..||.:.::..|.
Mosquito   137 AAAAAAKKPKVTKKKKKRD---PNEPQKPVSAYALFFRDTQAAIKGQNPNASFGEVSKIVASMWD 198

  Fly   118 DADAQLKERLQAEFKRDQQIYVEERTKYDATLTEEQRAEIKQLKQDLVDAKERRQLRKRVKELGR 182
            ....:.|...:.:.:..::.|::....|.|:|..:...:  |::|.....:.:.|..|:.::...
Mosquito   199 VLATEHKNVYKKKTEAAKKDYLKALAAYRASLVSKMSHQ--QMQQQQQQQQFQHQHIKQEQQFQH 261

  Fly   183 PKKPASAFLRFIASERINTPQGDKQTYREWHQKTTAKWTRLSDSEKEVYMQESRKEMELYRK 244
                     :.|..|:....|..||. ::.||:...: ..|...:::.::|:..::::|.::
Mosquito   262 ---------QHIKQEQQFQHQHIKQE-QQMHQQQLQQ-QELHHHQQQHHLQQHEQQIQLQQQ 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 14/63 (22%)
HMGB-UBF_HMG-box 183..247 CDD:238686 10/62 (16%)
AgaP_AGAP000281XP_310839.5 HMG-box 159..224 CDD:238037 14/64 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.