DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and Dsp1

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:NP_001138203.1 Gene:Dsp1 / 117294 FlyBaseID:FBgn0278608 Length:397 Species:Drosophila melanogaster


Alignment Length:76 Identity:25/76 - (32%)
Similarity:48/76 - (63%) Gaps:0/76 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 EQLGLPPRPKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLSKNWSDADAQLKERLQAEFKRD 134
            :|:..|..||:.|:.:|.|..::|.|:||.||:....::.::|.:.|||.|.::|::.::..:||
  Fly   267 KQIKDPNAPKRSLSAFFWFCNDERNKVKALNPEFGVGDIAKELGRKWSDVDPEVKQKYESMAERD 331

  Fly   135 QQIYVEERTKY 145
            :..|..|.|:|
  Fly   332 KARYEREMTEY 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 20/63 (32%)
HMGB-UBF_HMG-box 183..247 CDD:238686
Dsp1NP_001138203.1 HMG-box 182..252 CDD:294061
HMGB-UBF_HMG-box 275..339 CDD:238686 20/63 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR48112
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.