DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and LOC110438871

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_021328034.1 Gene:LOC110438871 / 110438871 -ID:- Length:205 Species:Danio rerio


Alignment Length:184 Identity:42/184 - (22%)
Similarity:78/184 - (42%) Gaps:30/184 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 PPRPKKPLTPYFRFMREQRPKLKAANPQITT--VEVVRQLSKNWSDADAQLKERLQAEFKRDQQI 137
            |.:|:..::.|..|::..|.:.|..:|:.|.  .|..::.|:.|....|:.|.:.:...|.|:..
Zfish     5 PTKPRGKMSSYAYFVQTCREEHKKKHPEATVNFSEFSKKCSERWKTMSAKEKGKFEDMAKLDKAR 69

  Fly   138 YVEERTKYDATLTEEQRAEIKQLKQDLVDAKERRQLRKRVKELGRPKKPASAFLRFIASERINTP 202
            |..|...|                     ...:.:.:||.|:...||:|.|||..|.:..|   |
Zfish    70 YEREMKNY---------------------IPPKGEKKKRFKDPNAPKRPPSAFFIFCSEFR---P 110

  Fly   203 QGDKQT----YREWHQKTTAKWTRLSDSEKEVYMQESRKEMELYRKAISVWEEK 252
            :..::|    ..:..::....|.::|..||:.|.:::.|..|.|.|.|:.:..|
Zfish   111 KVKEETPGLSIGDVAKRLGEMWNKISSEEKQPYEKKAAKLKEKYEKDIAAYRSK 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 15/65 (23%)
HMGB-UBF_HMG-box 183..247 CDD:238686 19/67 (28%)
LOC110438871XP_021328034.1 HMG-box 7..77 CDD:320749 16/69 (23%)
HMG_box 94..161 CDD:278906 20/69 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.