DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and LOC108350839

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_017448593.1 Gene:LOC108350839 / 108350839 RGDID:11440908 Length:214 Species:Rattus norvegicus


Alignment Length:215 Identity:46/215 - (21%)
Similarity:81/215 - (37%) Gaps:43/215 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GLPPRPKKPLTPYFRFM---REQRPKLKAANPQITTVEVVRQLSKNWSDADAQLKERLQAEFKRD 134
            |.|.:|:..::.:..|:   ||:..| |..|..:...|..::.|:.|....|:.|.:.:...|.|
  Rat     4 GYPKKPRGKMSSHAFFVQTCREEHKK-KHLNASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKAD 67

  Fly   135 QQIYVEERTKYDATLTEEQRAEIKQLKQDLVDAKERRQLRKRVKELGRPKKPASAFLRF------ 193
            :..|..|...|                     ...:.:.:|:.|:....|:|.|||..|      
  Rat    68 KARYEREMKTY---------------------IPPKGETKKKFKDPNALKRPPSAFFLFCSEYRP 111

  Fly   194 -IASERINTPQGDKQTYREWHQKTTAKWTRLSDSEKEVYMQESRKEMELYRKAISVWEEKMIRLG 257
             |..|......||..      :|....||..:..:|:...:::.|..|.|.|.|:.:..|    |
  Rat   112 KIKGEHPGLSIGDVA------KKLGEMWTNTAVDDKQPCEKKAAKLKEKYEKDIAAYRAK----G 166

  Fly   258 HIDVVRHGNLIDPPEPKPRK 277
            ..|..:.| ::...:.|.:|
  Rat   167 KPDAAKKG-VVKAEKSKKKK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 15/66 (23%)
HMGB-UBF_HMG-box 183..247 CDD:238686 18/70 (26%)
LOC108350839XP_017448593.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.