DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and LOC108349189

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_038956208.1 Gene:LOC108349189 / 108349189 RGDID:11468204 Length:213 Species:Rattus norvegicus


Alignment Length:214 Identity:46/214 - (21%)
Similarity:82/214 - (38%) Gaps:41/214 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 GLPPRPKKPLTPYFRFMREQRPKLKAANP--QITTVEVVRQLSKNWSDADAQLKERLQAEFKRDQ 135
            |.|.:|:..::.|..|::..|.:.|..:|  .:...|..::.|:.|....|:.|.:.:...|.|:
  Rat     4 GDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADK 68

  Fly   136 QIYVEERTKYDATLTEEQRAEIKQLKQDLVDAKERRQLRKRVKELGRPKKPASAFLRF------- 193
            ..|..|...|                     ...:.:.:|:.|:...||:|.|||..|       
  Rat    69 ARYEREMKTY---------------------IPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPK 112

  Fly   194 IASERINTPQGDKQTYREWHQKTTAKWTRLSDSEKEVYMQESRKEMELYRKAISVWEEKMIRLGH 258
            |..|......||..      :|....|...:..:|:.|.:::.|..|.|.|.|:.:..|    |.
  Rat   113 IKGEHPGLSIGDVA------KKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAK----GK 167

  Fly   259 IDVVRHGNLIDPPEPKPRK 277
            .|..:.| ::...:.|.:|
  Rat   168 PDAAKKG-VVKAEKSKKKK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 14/65 (22%)
HMGB-UBF_HMG-box 183..247 CDD:238686 19/70 (27%)
LOC108349189XP_038956208.1 HMG_box_2 6..78 CDD:401091 16/71 (23%)
HMG_box 95..162 CDD:395407 20/72 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.