Sequence 1: | NP_732527.1 | Gene: | TFAM / 42433 | FlyBaseID: | FBgn0038805 | Length: | 284 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_006330.2 | Gene: | HMG20B / 10362 | HGNCID: | 5002 | Length: | 317 | Species: | Homo sapiens |
Alignment Length: | 215 | Identity: | 47/215 - (21%) |
---|---|---|---|
Similarity: | 87/215 - (40%) | Gaps: | 61/215 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 74 LPPRPKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLSKNWSDADAQLKERLQAEFKRDQQIY 138
Fly 139 VEERTKYDAT-----LTEE-QRAEIKQ------------------------------LKQDLVDA 167
Fly 168 KERRQLRKRVKELGRPKKPASAFLRFIASERINTPQGDKQTYREWHQKTTAKWTRLSDSEKEVYM 232
Fly 233 QESR-----KEMELYRKAIS 247 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
TFAM | NP_732527.1 | HMGB-UBF_HMG-box | 78..142 | CDD:238686 | 20/63 (32%) |
HMGB-UBF_HMG-box | 183..247 | CDD:238686 | 12/68 (18%) | ||
HMG20B | NP_006330.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..71 | 2/4 (50%) | |
HMGB-UBF_HMG-box | 70..135 | CDD:238686 | 21/64 (33%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5648 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |