DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and tfam

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_002937148.2 Gene:tfam / 100135718 XenbaseID:XB-GENE-978256 Length:281 Species:Xenopus tropicalis


Alignment Length:187 Identity:57/187 - (30%)
Similarity:93/187 - (49%) Gaps:5/187 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 PKKPLTPYFRFMREQRPKLKAANPQITTVEVVRQLSKNWSDADAQLKERLQAEFKRDQQIYVEER 142
            ||:|||.|.|:..||||||....|:...:::.:.::..|....:..|||.:.....:|:.|.||.
 Frog    55 PKRPLTAYLRYSIEQRPKLHKQYPEAKMMDLTKIIALEWKGLPSAEKERYEVVANAEQKKYREEV 119

  Fly   143 TKYDATLTEEQ-RAEIKQLKQDLVDAKERRQLRKRVKELGRPKKPASAFLRFIASERINTPQGDK 206
            .:|...|:..| ....:|.:|.|...|..|: ::.:..|||||:|.|.|..|: ||.....:|..
 Frog   120 KQYREKLSPMQLELHREQRRQRLAKRKSVRK-KRELTVLGRPKRPRSPFNIFM-SEHFQDAKGAS 182

  Fly   207 QTYREWHQKTTAKWTRLSDSEKEVYMQESRKEMELYRKAISVWEEKMIRLGHIDVVR 263
            ...:  .:.....|.||..|:|:.|.|.:..:...|...:..|||:|:.:|..|::|
 Frog   183 SQSK--MKSLRDDWERLHTSQKQTYNQLAEDDKIRYENEMKSWEEQMMEIGRGDLIR 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 21/63 (33%)
HMGB-UBF_HMG-box 183..247 CDD:238686 17/63 (27%)
tfamXP_002937148.2 HMGB-UBF_HMG-box 55..120 CDD:238686 22/64 (34%)
HMGB-UBF_HMG-box 160..221 CDD:238686 17/63 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H31139
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 1 1.000 - - FOG0007031
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR48112
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.