DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TFAM and bbx

DIOPT Version :9

Sequence 1:NP_732527.1 Gene:TFAM / 42433 FlyBaseID:FBgn0038805 Length:284 Species:Drosophila melanogaster
Sequence 2:XP_009303743.1 Gene:bbx / 100005540 -ID:- Length:899 Species:Danio rerio


Alignment Length:321 Identity:63/321 - (19%)
Similarity:117/321 - (36%) Gaps:83/321 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IGSLINKVRQVVAKDWPPSDPSRANDTDHRPLTPPRPLAAASISNTPAVPSKTLEEQLGLPPRPK 79
            :.|:...:..||...|      .:.:|..:...||...::.:...:|:|..||       .|:||
Zfish   436 LDSVTFTIEAVVKGAW------GSEETPKKKPRPPESESSLTAEQSPSVKKKT-------KPKPK 487

  Fly    80 KPLTPYFRFMREQRPKL-KAAN-PQITTVEVVRQ----LSKNWSDADAQLK-------ERLQAEF 131
            |.|......|:|:.... |.|| ||  .||::.:    ..|...:.:..:|       |....:|
Zfish   488 KQLKLKDDAMQEEEEDADKVANKPQ--DVEMITEEAPMTPKTECEDEFDVKVEPPCGMEDAMLQF 550

  Fly   132 KRDQQIYVEERTKYDA-TLTEEQRAEIKQLKQDLVDAKERRQLRKRVKELGRPKKPASAFLRFIA 195
            ...:...|:|:...|| .|...|..:..::||::..:::..:..|            .|..:.:.
Zfish   551 SPMEPTEVDEKEDSDAKPLESRQEDKDPEVKQEVCGSRKSERSCK------------GALYKTLV 603

  Fly   196 SE------RINTPQGDKQTYR--------EWHQK---------TTAKWTRLSDSEKEVYMQESRK 237
            ||      |.|..:|.:.:.|        .|:.:         :..|..:.|.|:.|......:.
Zfish   604 SEGMLTSLRANVDRGKRGSMRGSVSDHEGSWNDENWGFSQAATSNPKKLKKSKSKDETTPGLGKL 668

  Fly   238 EMELYRKAISV-------WEEKMIRLGHIDVVRHGNLIDPPEP---------KPRKTLASK 282
            |.|..:|..|:       :::|.:.   :...:..:...||||         ..:|||..|
Zfish   669 EEEFEKKFNSLPQYSPLTFDKKSVA---VTKKKKNSTSSPPEPPKTCKGSSSSQKKTLFHK 726

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TFAMNP_732527.1 HMGB-UBF_HMG-box 78..142 CDD:238686 18/76 (24%)
HMGB-UBF_HMG-box 183..247 CDD:238686 15/86 (17%)
bbxXP_009303743.1 SOX-TCF_HMG-box 83..154 CDD:238684
DUF2028 199..344 CDD:312980
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1641977at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.