DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and MRX21

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_015336.1 Gene:MRX21 / 856121 SGDID:S000006215 Length:326 Species:Saccharomyces cerevisiae


Alignment Length:312 Identity:105/312 - (33%)
Similarity:163/312 - (52%) Gaps:41/312 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 ISLISGAAAGALAKTVIAPLDRTKINFQIRNDVPFSFRASLRYLQNTYANEGVLALWRGNSATMA 138
            |:.::|..|||:::||::|.:|.||..|:::......|.....::..|..||...|:|||.....
Yeast    24 IAFLAGGVAGAVSRTVVSPFERVKILLQVQSSTTSYNRGIFSSIRQVYHEEGTKGLFRGNGLNCI 88

  Fly   139 RIVPYAAIQFTAHEQW-RRILHVDKDGTN-----TKGRRFLAGSLAGITSQSLTYPLDLARARMA 197
            ||.||:|:||..:|.. :::.||  :|.|     |..:|..:|:|.|..|...||||||.:.|::
Yeast    89 RIFPYSAVQFVVYEACKKKLFHV--NGNNGQEQLTNTQRLFSGALCGGCSVVATYPLDLIKTRLS 151

  Fly   198 VTDRYTGYRTLRQVFTK-------IW--------VEEGPRTLFRGYWATVLGVIPYAGTSFFTYE 247
            :  :.....:|.:...|       ||        :|.|.|.|:||.|.|.|||:||...:|..||
Yeast   152 I--QTANLSSLNRSKAKSISKPPGIWQLLSETYRLEGGLRGLYRGVWPTSLGVVPYVALNFAVYE 214

  Fly   248 TLKREYYEVVGNNKP---NTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGD----RY 305
            .| ||:.....:.:|   :.|..|..||.:|...||.:||.|::|||.|.:.:   ||:    ||
Yeast   215 QL-REFGVNSSDAQPSWKSNLYKLTIGAISGGVAQTITYPFDLLRRRFQVLAM---GGNELGFRY 275

  Fly   306 PTILETLVKIYREEGVKNGFYKGLSMNWIKGPIAVGISFSTY----DLIKAW 353
            .::.:.||.|.|.||| :|:||||:.|..|...:..:|:..|    |.::.|
Yeast   276 TSVWDALVTIGRAEGV-SGYYKGLAANLFKVVPSTAVSWLVYEVVCDSVRNW 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 28/85 (33%)
Mito_carr 169..251 CDD:278578 33/96 (34%)
Mito_carr 279..356 CDD:278578 31/83 (37%)
MRX21NP_015336.1 PTZ00169 26..304 CDD:240302 99/286 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0752
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54381
OrthoFinder 1 1.000 - - FOG0001300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100703
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1887
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.710

Return to query results.
Submit another query.