DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and TPC1

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_011610.3 Gene:TPC1 / 852988 SGDID:S000003328 Length:314 Species:Saccharomyces cerevisiae


Alignment Length:292 Identity:78/292 - (26%)
Similarity:142/292 - (48%) Gaps:23/292 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SLISGAAAGALAKTVIAPLDRTKINFQI--RNDV-PFSFRASLRYLQNTYANEGVLALWRGNSAT 136
            :|::||.:|.||:::.||:|..||..|:  .|.: ||..:. :...::...|||:.:.|:||...
Yeast    19 TLLAGAVSGLLARSITAPMDTIKIRLQLTPANGLKPFGSQV-MEVARSMIKNEGIRSFWKGNIPG 82

  Fly   137 MARIVPYAAIQFTAHEQWRRILHVDKDGTNTKGRRFLAGSLAGITSQSLTYPLDLARARMAVTDR 201
            ....|.|.:.||:::..:.|  ::...|...:....:.|:.|||||..::||.|:.|.|:...::
Yeast    83 SLLYVTYGSAQFSSYSLFNR--YLTPFGLEARLHSLVVGAFAGITSSIVSYPFDVLRTRLVANNQ 145

  Fly   202 YTGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLK---REYYEVVGNNKPN 263
            .......|:| ..||..||....|:|..|::..:...|...|.||||::   .|..:....:|..
Yeast   146 MHSMSITREV-RDIWKLEGLPGFFKGSIASMTTITLTASIMFGTYETIRIYCDENEKTTAAHKKW 209

  Fly   264 TLVSL--AFGAAAGAAGQTASYPLDIVRRRMQTMR-VNTAGGDRYPTILETL---------VKIY 316
            .|.:|  :.|...|...:..::||:.:|||||.|. .:.....|:.::..:.         ::|.
Yeast   210 ELATLNHSAGTIGGVIAKIITFPLETIRRRMQFMNSKHLEKFSRHSSVYGSYKGYGFARIGLQIL 274

  Fly   317 REEGVKNGFYKGLSMNWIKGPIAVGISFSTYD 348
            ::||| :..|:|:.:...|......:||..|:
Yeast   275 KQEGV-SSLYRGILVALSKTIPTTFVSFWGYE 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 26/86 (30%)
Mito_carr 169..251 CDD:278578 26/84 (31%)
Mito_carr 279..356 CDD:278578 19/80 (24%)
TPC1NP_011610.3 Mito_carr 16..105 CDD:395101 26/88 (30%)
PTZ00169 21..285 CDD:240302 72/268 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0752
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.