DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and AT1G78180

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_565171.4 Gene:AT1G78180 / 844154 AraportID:AT1G78180 Length:418 Species:Arabidopsis thaliana


Alignment Length:299 Identity:74/299 - (24%)
Similarity:131/299 - (43%) Gaps:37/299 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LISGAAAGALAKTVIAPLDRTKINFQIRNDVPFSFRASLRYLQNTYANEGVLALWRGNSATMARI 140
            |.:||.|..::||.:|||:|.|:.:.:|.:.    |..|...::....:|:...|:||...:.|.
plant   128 LWAGAVAAMVSKTFLAPLERLKLEYTVRGEQ----RNLLVVAKSIATTQGLTGFWKGNLLNVLRT 188

  Fly   141 VPYAAIQFTAHEQWRR-ILHVDKDGTNTKGRRFLAGSLAGITSQSLTYPLDLARARMAVTDRYTG 204
            .|:.|:.|.|::.:|: :|.:..:...|...||:||:.||||:..|..|||..|.::..    .|
plant   189 APFKAVNFCAYDTYRKQLLK
IAGNQEATNFERFVAGAAAGITATVLCLPLDTIRTKLVA----RG 249

  Fly   205 YRTLRQV---FTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKREYYEVVGNNKP---- 262
            ...|..:   |..:...||..:|::|...::..:.......:..|:.||..:.......|.    
plant   250 GEALGGIGGAFRYMIQTEGLFSLYKGLVPSIASMALSGAVFYGVYDILKSSFLHTPEGRKRLIDM 314

  Fly   263 ---------------NTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGDRYPTILETL 312
                           ..:.:|.:||.|||..:.|:||.::|||::|...     |......|...
plant   315 KQQGQELNALDRLELGPIRTLMYGAIAGACTEVATYPFEVVRRQLQMQM-----GKNKLNALAMG 374

  Fly   313 VKIYREEGVKNGFYKGLSMNWIKGPIAVGISFSTYDLIK 351
            ..|....|:. ..|.||..:.::...:..||:..|:.:|
plant   375 FNIIERGGIP-ALYAGLLPSLLQVLPSASISYFVYECMK 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 24/83 (29%)
Mito_carr 169..251 CDD:278578 22/84 (26%)
Mito_carr 279..356 CDD:278578 18/73 (25%)
AT1G78180NP_565171.4 Mito_carr 120..208 CDD:395101 24/83 (29%)
Mito_carr <237..303 CDD:395101 14/69 (20%)
Mito_carr 328..415 CDD:395101 24/91 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0752
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54381
OrthoDB 1 1.010 - - D1253450at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.