DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and AT1G14560

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_172908.1 Gene:AT1G14560 / 838018 AraportID:AT1G14560 Length:331 Species:Arabidopsis thaliana


Alignment Length:302 Identity:115/302 - (38%)
Similarity:173/302 - (57%) Gaps:29/302 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SLISGAAAGALAKTVIAPLDRTKINFQIR-NDVPFSFRASLRYLQNTYANEGVLALWRGNSATMA 138
            :||:|.||||:|||.:|||:|.||..|.| ||  |......:.|:.....:|.|..::||.|::.
plant    26 TLIAGGAAGAIAKTAVAPLERIKILLQTRTND--FKTLGVSQSLKKVLQFDGPLGFYKGNGASVI 88

  Fly   139 RIVPYAAIQFTAHEQWRRILHVDKDGTNTKGR--RFLAGSLAGITSQSLTYPLDLARARMA--VT 199
            ||:||||:.:..:|.:|..: ::|:.....|.  ..:|||.||.|:...||||||||.::|  |:
plant    89 RIIPYAALHYMTYEVYRDWI-LEKNLPLGSGPIVDLVAGSAAGGTAVLCTYPLDLARTKLAYQVS 152

  Fly   200 D-------------RYTGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKR 251
            |             |...|..:::|....:.|.|||.|:||...|::|::||||..|:.||.|||
plant   153 DTRQSLRGGANGFYRQPTYSGIKEVLAMAYKEGGPRGLYRGIGPTLIGILPYAGLKFYIYEELKR 217

  Fly   252 EYYEVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQ--TMRVNTAGGD--RYPTILETL 312
            ...|   .::.:..:.|..||.||..|||.:||||:|||:||  .::..|:.|:  ||....:.|
plant   218 HVPE---EHQNSVRMHLPCGALAGLFGQTITYPLDVVRRQMQVENLQPMTSEGNNKRYKNTFDGL 279

  Fly   313 VKIYREEGVKNGFYKGLSMNWIKGPIAVGISFSTYDLIKAWL 354
            ..|.|.:|.|. .:.|||:|:||...:|.|.|:.|:.:|:|:
plant   280 NTIVRTQGWKQ-LFAGLSINYIKIVPSVAIGFTVYESMKSWM 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 35/84 (42%)
Mito_carr 169..251 CDD:278578 38/98 (39%)
Mito_carr 279..356 CDD:278578 32/80 (40%)
AT1G14560NP_172908.1 PTZ00169 38..301 CDD:240302 99/269 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 72 1.000 Domainoid score I3303
eggNOG 1 0.900 - - E1_KOG0752
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 180 1.000 Inparanoid score I1459
OMA 1 1.010 - - QHG54381
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001300
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100703
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X798
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.730

Return to query results.
Submit another query.