DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and AT5G64970

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_201302.1 Gene:AT5G64970 / 836621 AraportID:AT5G64970 Length:428 Species:Arabidopsis thaliana


Alignment Length:302 Identity:84/302 - (27%)
Similarity:141/302 - (46%) Gaps:37/302 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LISGAAAGALAKTVIAPLDRTKINFQIRNDVPFSFRASLRYLQNTYANEGVLALWRGNSATMARI 140
            |.:||.|..:::|.||||:|.|:.:.:|.:.    ...|..:|....|||:...|:||...:.|.
plant   135 LWAGAFAAMVSRTCIAPLERMKLEYIVRGEQ----GNLLELIQRIATNEGIRGFWKGNLVNILRT 195

  Fly   141 VPYAAIQFTAHEQWR-RILHVDKDGTNTKGRRFLAGSLAGITSQSLTYPLDLARARMAVTDRYTG 204
            .|:.:|.|.|::.:| ::|.:..:...|...||:||:.||:|:..|..|||..|..|..    .|
plant   196 APFKSINFYAYDTYRGQLLKLSGNEETTNFERFVAGAAAGVTASLLCLPLDTIRTVMVA----PG 256

  Fly   205 YRTLRQV---FTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKREYYEVVGNNKP---- 262
            ...|..|   |..:...||..:|::|...:::.:.|.....:..|:.||..|.......|.    
plant   257 GEALGGVVGAFRHMIQTEGFFSLYKGLVPSLVSMAPSGAVFYGVYDILKSAYLHTPEGKKRLEHM 321

  Fly   263 ---------------NTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGDRYPTILETL 312
                           ..:.:|.:||.|||..:.|:||.::||||:| |:.:.    :..:.:.|.
plant   322 KQEGEELNAFDQLELGPMRTLLYGAIAGACSEAATYPFEVVRRRLQ-MQSHA----KRLSAVATC 381

  Fly   313 VKIYREEGVKNGFYKGLSMNWIKGPIAVGISFSTYDLIKAWL 354
            |||..:.||. ..|.||..:.::...:..||:..|:.:|..|
plant   382 VKIIEQGGVP-ALYAGLIPSLLQVLPSAAISYFVYEFMKVVL 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 26/83 (31%)
Mito_carr 169..251 CDD:278578 24/84 (29%)
Mito_carr 279..356 CDD:278578 23/76 (30%)
AT5G64970NP_201302.1 Mito_carr 127..215 CDD:278578 26/83 (31%)
PTZ00169 130..421 CDD:240302 83/299 (28%)
Mito_carr 239..310 CDD:278578 19/74 (26%)
Mito_carr 335..422 CDD:278578 28/92 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0752
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54381
OrthoDB 1 1.010 - - D1253450at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.