DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and AT3G55640

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001319759.1 Gene:AT3G55640 / 824730 AraportID:AT3G55640 Length:332 Species:Arabidopsis thaliana


Alignment Length:302 Identity:109/302 - (36%)
Similarity:167/302 - (55%) Gaps:27/302 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LISGAAAGALAKTVIAPLDRTKINFQIR----NDVPFSFRASLRYLQNTYANEGVLALWRGNSAT 136
            |::|..|||.:||..|||.|..|.||::    |.......:.|.........||:.|.|:||..|
plant    38 LLAGGLAGAFSKTCTAPLSRLTILFQVQGMHTNAAALRKPSILHEASRILNEEGLKAFWKGNLVT 102

  Fly   137 MARIVPYAAIQFTAHEQWRRILHV------DKDGTNTK-GRRFLAGSLAGITSQSLTYPLDLARA 194
            :|..:||:::.|.|:|.:::.:::      .|:|.::. ...|:||.|||||:.|.||||||.|.
plant   103 IAHRLPYSSVNFYAYEHYKKFMYMVTGMENHKEGISSNLFVHFVAGGLAGITAASATYPLDLVRT 167

  Fly   195 RMAVTDR---YTG-YRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKREYYE 255
            |:|...:   |:| :.|||.:.|    :||...|::|...|::||.|....||..||:| |.|:.
plant   168 RLAAQTKVIYYSGIWHTLRSITT----DEGILGLYKGLGTTLVGVGPSIAISFSVYESL-RSYWR 227

  Fly   256 VVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGDR--YPT-ILETLVKIYR 317
            ....:....:||||.|:.:|.|..||::|||:||||.|   :...||..  |.| :|.||.:|.:
plant   228 STRPHDSPIMVSLACGSLSGIASSTATFPLDLVRRRKQ---LEGIGGRAVVYKTGLLGTLKRIVQ 289

  Fly   318 EEGVKNGFYKGLSMNWIKGPIAVGISFSTYDLIKAWLTELAN 359
            .||.: |.|:|:...:.|....|||.|.||:.:|.:..:|::
plant   290 TEGAR-GLYRGILPEYYKVVPGVGICFMTYETLKLYFKDLSS 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 29/86 (34%)
Mito_carr 169..251 CDD:278578 37/85 (44%)
Mito_carr 279..356 CDD:278578 31/79 (39%)
AT3G55640NP_001319759.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0752
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54381
OrthoDB 1 1.010 - - D1253450at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.790

Return to query results.
Submit another query.