DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and AT3G53940

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_190962.2 Gene:AT3G53940 / 824561 AraportID:AT3G53940 Length:365 Species:Arabidopsis thaliana


Alignment Length:373 Identity:121/373 - (32%)
Similarity:181/373 - (48%) Gaps:49/373 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GSQLSSTMTTASATLSSDLDDADTSRTQLSPSETSGVVLVPATTVTPM--------RQKIDQ--- 71
            |.|.:....|.:|..::.:|..:....|..|.          |..|..        :|.::|   
plant    11 GGQRALNTATTTAVHNTVVDAGNRKLLQQQPQ----------TQQTQSCHQHHQSNKQSLNQQQG 65

  Fly    72 ---VVISLISGAAAGALAKTVIAPLDRTKINFQIRNDVPFSFRASLRYLQNTY-------ANEGV 126
               .|..|::|..|||.:||..|||.|..|.|||:.   ....|::....|.:       ..||.
plant    66 HFGTVERLLAGGIAGAFSKTCTAPLARLTILFQIQG---MQSEAAILSSPNIWHEASRIVKEEGF 127

  Fly   127 LALWRGNSATMARIVPYAAIQFTAHEQWRRILHVDKDGTNTKGR-------RFLAGSLAGITSQS 184
            .|.|:||..|:|..:||.|:.|.|:|:::..||.:....:.||.       .|::|.|||:|:.|
plant   128 RAFWKGNLVTVAHRLPYGAVNFYAYEEYKTFLHSNPVLQSYKGNAGVDISVHFVSGGLAGLTAAS 192

  Fly   185 LTYPLDLARARMAVTDRYTGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETL 249
            .||||||.|.|::.......|:.:...|..|..|||...|::|..||:|||.|....||..|||.
plant   193 ATYPLDLVRTRLSAQRNSIYYQGVGHAFRTICREEGILGLYKGLGATLLGVGPSLAISFAAYETF 257

  Fly   250 KREYYEVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGDR--YPT-ILET 311
            | .::.....|..|.:|||..|:.:|....||::|||:||||||   :..|||..  |.| :..|
plant   258 K-TFWLSHRPNDSNAVVSLGCGSLSGIVSSTATFPLDLVRRRMQ---LEGAGGRARVYTTGLFGT 318

  Fly   312 LVKIYREEGVKNGFYKGLSMNWIKGPIAVGISFSTYDLIKAWLTELAN 359
            ...|::.||:: |.|:|:...:.|....|||:|.|::.:|..|:.:.|
plant   319 FKHIFKTEGMR-GLYRGIIPEYYKVVPGVGIAFMTFEELKKLLSTVPN 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 32/93 (34%)
Mito_carr 169..251 CDD:278578 35/88 (40%)
Mito_carr 279..356 CDD:278578 31/79 (39%)
AT3G53940NP_190962.2 PTZ00169 74..360 CDD:240302 106/293 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0752
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54381
OrthoDB 1 1.010 - - D1253450at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X798
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.790

Return to query results.
Submit another query.