DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and AT2G37890

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_181325.2 Gene:AT2G37890 / 818365 AraportID:AT2G37890 Length:337 Species:Arabidopsis thaliana


Alignment Length:357 Identity:126/357 - (35%)
Similarity:178/357 - (49%) Gaps:51/357 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GSQLSSTMTTASATLSSDLDDADTSRTQLSPSETSGVVLVPATTVTPMRQKIDQVVISLISGAAA 82
            |:|  |.:.||:...||      ...||:.|....|...                  :|::|..|
plant    13 GAQ--SALNTATTVHSS------VVMTQIKPQAKLGTFQ------------------NLLAGGIA 51

  Fly    83 GALAKTVIAPLDRTKINFQI---RNDVPFSFRASLRYLQNTYAN-EGVLALWRGNSATMARIVPY 143
            ||::||..|||.|..|.||:   :::.....|.:||...:...| ||..|.|:||..|:...:||
plant    52 GAISKTCTAPLARLTILFQLQGMQSEGAVLSRPNLRREASRIINEEGYRAFWKGNLVTVVHRIPY 116

  Fly   144 AAIQFTAHEQWRRILH----VDKDGTNTKGR---RFLAGSLAGITSQSLTYPLDLARARMAVTDR 201
            .|:.|.|:|::....:    |.....||.|.   .|::|.|||||:.:.||||||.|.|:|....
plant   117 TAVNFYAYEKYNLFFNSNPVVQSFIGNTSGNPIVHFVSGGLAGITAATATYPLDLVRTRLAAQRN 181

  Fly   202 YTGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKREYYEVVGNNKPN--- 263
            ...|:.:...|..|..|||...|::|..||:|||.|....:|..||::|..::    :::||   
plant   182 AIYYQGIEHTFRTICREEGILGLYKGLGATLLGVGPSLAINFAAYESMKLFWH----SHRPNDSD 242

  Fly   264 TLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGDR--YPT-ILETLVKIYREEGVKNGF 325
            .:|||..|..|||...||:||||:||||||   |..|||..  |.| :..|...|::.||.| |.
plant   243 LVVSLVSGGLAGAVSSTATYPLDLVRRRMQ---VEGAGGRARVYNTGLFGTFKHIFKSEGFK-GI 303

  Fly   326 YKGLSMNWIKGPIAVGISFSTYDLIKAWLTEL 357
            |:|:...:.|....|||.|.|||.::..||.|
plant   304 YRGILPEYYKVVPGVGIVFMTYDALRRLLTSL 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 31/90 (34%)
Mito_carr 169..251 CDD:278578 34/84 (40%)
Mito_carr 279..356 CDD:278578 35/79 (44%)
AT2G37890NP_181325.2 PTZ00169 44..332 CDD:240302 112/295 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0752
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54381
OrthoDB 1 1.010 - - D1253450at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.790

Return to query results.
Submit another query.