DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and Slc25a42

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_006253013.1 Gene:Slc25a42 / 689414 RGDID:1592346 Length:329 Species:Rattus norvegicus


Alignment Length:187 Identity:110/187 - (58%)
Similarity:134/187 - (71%) Gaps:13/187 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 QVVISLISGAAAGALAKTVIAPLDRTKINFQIRNDVPFSFRASLRYLQNTYANEGVLALWRGNSA 135
            ||:.||:|||.|||||||.:||||||||.||: :...||.:.:.|.|..||.|||.|:|||||||
  Rat    77 QVLSSLLSGALAGALAKTAVAPLDRTKIIFQV-SSKRFSAKEAFRLLYFTYLNEGFLSLWRGNSA 140

  Fly   136 TMARIVPYAAIQFTAHEQWRRIL-HVDKDGTNTKGR------RFLAGSLAGITSQSLTYPLDLAR 193
            ||.|::|||||||:|||:::||| |.    ...:|.      |.|||:|||.|:.||||||||.|
  Rat   141 TMVRVIPYAAIQFSAHEEYKRILGHY----YGFRGEALPPWPRLLAGALAGTTAASLTYPLDLVR 201

  Fly   194 ARMAVTDRYTGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLK 250
            ||||||.:.. |..:..||.:|..|||.:||:.|:..||||||||||.||||||:||
  Rat   202 ARMAVTPKEM-YSNIFHVFIRISREEGLKTLYFGFTPTVLGVIPYAGLSFFTYESLK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 56/87 (64%)
Mito_carr 169..251 CDD:278578 52/88 (59%)
Mito_carr 279..356 CDD:278578
Slc25a42XP_006253013.1 Mito_carr 74..167 CDD:278578 58/94 (62%)
Mito_carr <192..259 CDD:278578 43/67 (64%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166346703
Domainoid 1 1.000 112 1.000 Domainoid score I6093
eggNOG 1 0.900 - - E1_KOG0752
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H74852
Inparanoid 1 1.050 299 1.000 Inparanoid score I2629
OMA 1 1.010 - - QHG54381
OrthoDB 1 1.010 - - D1253450at2759
OrthoFinder 1 1.000 - - FOG0001300
OrthoInspector 1 1.000 - - oto97565
orthoMCL 1 0.900 - - OOG6_100703
Panther 1 1.100 - - LDO PTHR24089
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X798
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.