DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and slc25a25b

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_009299818.1 Gene:slc25a25b / 569227 ZFINID:ZDB-GENE-060526-340 Length:536 Species:Danio rerio


Alignment Length:294 Identity:104/294 - (35%)
Similarity:157/294 - (53%) Gaps:34/294 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LISGAAAGALAKTVIAPLDRTKINFQI---RND---VPFSFRASLRYLQNTYANEGVLALWRGNS 134
            |::|..|||:::|..|||||.|:..|:   |::   :...|...:|       ..|:.:|||||.
Zfish   257 LVAGGGAGAVSRTCTAPLDRLKVLMQVHATRSNSMGIAGGFTQMIR-------EGGLRSLWRGNG 314

  Fly   135 ATMARIVPYAAIQFTAHEQWRRILHVDKDGTN--TKG--RRFLAGSLAGITSQSLTYPLDLARAR 195
            ..:.:|.|.:||:|.|:||.:|::     |:|  |.|  .|.::|||||..:||..||:::.:.|
Zfish   315 INVLKIAPESAIKFMAYEQIKRLI-----GSN
QETLGILERLVSGSLAGAIAQSSIYPMEVLKTR 374

  Fly   196 MAV--TDRYTGYR-TLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKREYYE-- 255
            :|:  |.:|:|.. ..:.:|.|    ||....::||...:||:|||||.....|||||..:.:  
Zfish   375 LALGRTGQYSGIADCAKHIFKK----EGMTAFYKGYIPNMLGIIPYAGIDLAVYETLKNSWLQRF 435

  Fly   256 VVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGDRYPTILETLVKIYREEG 320
            ...:..|...|.||.|..:...||.|||||.:||.|||...  :..|....|:......|.|.||
Zfish   436 ATDSADPGVFVLLACGTMSSTCGQLASYPLALVRTRMQAQA--SQEGSPQMTMSGLFRHIVRTEG 498

  Fly   321 VKNGFYKGLSMNWIKGPIAVGISFSTYDLIKAWL 354
            . .|.|:||:.|::|...||.||:..|:.:|..|
Zfish   499 A-IGLYRGLAPNFMKVIPAVSISYVVYENLKITL 531

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 31/88 (35%)
Mito_carr 169..251 CDD:278578 33/86 (38%)
Mito_carr 279..356 CDD:278578 30/76 (39%)
slc25a25bXP_009299818.1 EFh 70..129 CDD:238008
EF-hand_7 71..131 CDD:290234
EFh 137..208 CDD:238008
EF-hand_7 138..205 CDD:290234
Mito_carr 253..341 CDD:278578 32/95 (34%)
Mito_carr 343..435 CDD:278578 35/95 (37%)
Mito_carr 441..532 CDD:278578 36/94 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1887
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.