DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and aralar1

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001247368.1 Gene:aralar1 / 43616 FlyBaseID:FBgn0028646 Length:707 Species:Drosophila melanogaster


Alignment Length:334 Identity:91/334 - (27%)
Similarity:145/334 - (43%) Gaps:28/334 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SSDLDDADTSRTQLSPSE-----TSGVVLVPATTVTPMRQKIDQVVIS---LISGAAAGALAKTV 89
            ||.:|.:|.|  .::|..     |..:..:.|......|....||:.|   ...|:.|||:..||
  Fly   309 SSRIDYSDLS--NIAPEHYTKHMTHRLAEIKAVESPADRSAFIQVLESSYRFTLGSFAGAVGATV 371

  Fly    90 IAPLDRTKINFQIRNDVPF----SFRASLRYLQNTYANEGVLALWRGNSATMARIVPYAAIQFTA 150
            :.|:|..|...|.:....:    ::|.|....:....:||.:.|:||....:..:.|..||:.|.
  Fly   372 VYPIDLVKTRMQNQRAGSYIGEVAYRNSWDCFKKVVRHEGFMGLYRGLLPQLMGVAPEKAIKLTV 436

  Fly   151 HEQWRRILHVDKDGTNTKGRRFLAGSLAGITSQSLTYPLDLARARMAVTDRYTGYRTLRQVFTKI 215
            ::..|..| .||.|........|||..||.:....|.||::.:.|:.|.........:|     .
  Fly   437 NDLVRDKL-TDKKGNIPTWAEVLAGGCAGASQVVFTNPLEIVKIRLQVAGEIASGSKIR-----A 495

  Fly   216 WV---EEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKREYYEVVGNNKPNTLVSLAFGAAAGAA 277
            |.   |.|...|::|..|.:|..:|::...|.||...|....:..|.|.|.||  ||.||.||..
  Fly   496 WSVVRELGLFGLYKGARACLLRDVPFSAIYFPTYAHTKAMMADKDGYNHPLTL--LAAGAIAGVP 558

  Fly   278 GQTASYPLDIVRRRMQTMRVNTAGGDRYPTILETLVKIYREEGVKNGFYKGLSMNWIKGPIAVGI 342
            ..:...|.|:::.|:|.  |..:|...|..:.:...||..|||.: .|:||.:....:.....|:
  Fly   559 AASLVTPADVIKTRLQV--VARSGQTTYTGVWDATKKIMAEEGPR-AFWKGTAARVFRSSPQFGV 620

  Fly   343 SFSTYDLIK 351
            :..||:|::
  Fly   621 TLVTYELLQ 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 24/93 (26%)
Mito_carr 169..251 CDD:278578 22/84 (26%)
Mito_carr 279..356 CDD:278578 19/73 (26%)
aralar1NP_001247368.1 EF-hand_7 35..99 CDD:290234
EF-hand_8 51..99 CDD:290545
EF-hand_7 81..134 CDD:290234
EFh 84..135 CDD:298682
EF-hand_7 111..173 CDD:290234
Mito_carr 350..448 CDD:278578 27/98 (28%)
PTZ00169 358..631 CDD:240302 79/283 (28%)
Mito_carr 449..539 CDD:278578 24/94 (26%)
Mito_carr 544..633 CDD:278578 28/91 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442002
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.