DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and CG1907

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_651703.1 Gene:CG1907 / 43483 FlyBaseID:FBgn0039674 Length:317 Species:Drosophila melanogaster


Alignment Length:302 Identity:78/302 - (25%)
Similarity:125/302 - (41%) Gaps:33/302 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ATTVTPMRQK-IDQVVISLISGAAAGALAKTVIAPLDRTKINFQI--RNDVPFSFRASLRYLQNT 120
            ||:|....:| :....|..:.|..:|..|..|:.|||..|...||  .......:|:||..:|..
  Fly     3 ATSVQEAPKKAVATNAIKFLFGGLSGMGATMVVQPLDLVKTRMQISGAGSGKKEYRSSLHCIQTI 67

  Fly   121 YANEGVLALWRGNSA--------TMARIVPYAAIQFTAHEQWRRILHVDKDGTNTKGRRFLAGSL 177
            .:.||.|||::|..|        |..|:..|..:.....|:::|...:...        ...|::
  Fly    68 VSKEGPLALYQGIGAALLRQATYTTGRLGMYTYLNDLFREKFQRSPGITDS--------MAMGTI 124

  Fly   178 AGITSQSLTYPLDLARARMA------VTDRYTGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVI 236
            ||.....:..|.::|..||.      |.:| ..|..:.....:|..|||...|:||...||...:
  Fly   125 AGACGAFIGTPAEVALVRMTSDGRLPVAER-RNYTNVANALARITREEGLTALWRGSLPTVGRAM 188

  Fly   237 PYAGTSFFTYETLKREYYEVVGNNKPNTLVSLAFGAA--AGAAGQTASYPLDIVRRRMQTMRVNT 299
            ....|...:|...|..:..  |..:....:.|.|.|:  :|......|.||||.:.|:|.|:: .
  Fly   189 VVNMTQLASYSQFKTYFRH--GPLQMEEGIKLHFCASMLSGLLTTITSMPLDIAKTRIQNMKM-V 250

  Fly   300 AGGDRYPTILETLVKIYREEGVKNGFYKGLSMNWIK-GPIAV 340
            .|...|....:.|:::.|:||| ...:||.:..:.: ||..|
  Fly   251 DGKPEYRGTADVLLRVARQEGV-FALWKGFTPYYCRLGPHTV 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 27/96 (28%)
Mito_carr 169..251 CDD:278578 21/87 (24%)
Mito_carr 279..356 CDD:278578 20/63 (32%)
CG1907NP_651703.1 Mito_carr 16..109 CDD:278578 26/92 (28%)
Mito_carr 118..207 CDD:278578 22/97 (23%)
Mito_carr 219..307 CDD:278578 23/75 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442050
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.