DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and mfrn

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_651600.1 Gene:mfrn / 43353 FlyBaseID:FBgn0039561 Length:379 Species:Drosophila melanogaster


Alignment Length:308 Identity:80/308 - (25%)
Similarity:138/308 - (44%) Gaps:38/308 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VPATTVTPMRQKIDQVVISLISGAAAGALAKTVIAPLDRTKINFQIRNDVPFSFRASLRYLQNTY 121
            :|.|:|.          :::.:||.||.|...|:.|||..|...|..:. |......:..|:...
  Fly     9 LPTTSVG----------VNMTAGAIAGVLEHVVMYPLDSVKTRMQSLSP-PTKNMNIVSTLRTMI 62

  Fly   122 ANEGVLALWRGNSATMARIVPYAAIQFTAHEQWRRILHVDKDGTNTKGRRF-LAGSLAGITSQSL 185
            ..||:|...||.||.:....|..::.|.|:|..:.:   ....|:.:...: ::|::|.:...::
  Fly    63 TREGLLRPIRGASAVVLGAGPAHSLYFAAYEMTKEL---TAKFTSVRNLNYVISGAVATLIHDAI 124

  Fly   186 TYPLDLARARMAVTDRYTGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYE--- 247
            :.|.|:.:.||.:.:  :.|.::......|:..||.:..:|.|...::..:||....|.|||   
  Fly   125 SSPTDVIKQRMQMYN--SPYTSVVSCVRDIYKREGFKAFYRAYGTQLVMNLPYQTIHFTTYEFFQ 187

  Fly   248 ---TLKREYYEVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGDRYPTIL 309
               .|:|:|      |.|   |.:|.||||||.....:.|||:::..:.|.......|     ::
  Fly   188 NKMNLERKY------NPP---VHMAAGAAAGACAAAVTTPLDVIKTLLNTQETGLTRG-----MI 238

  Fly   310 ETLVKIYREEGVKNGFYKGLSMNWIKGPIAVGISFSTYDLIKAWLTEL 357
            |...|||...| ..||::|.:...:....|..|.:|||:..|.:|..|
  Fly   239 EASRKIYHMAG-PLGFFRGTTARVLYSMPATAICWSTYEFFKFYLCGL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 24/86 (28%)
Mito_carr 169..251 CDD:278578 19/88 (22%)
Mito_carr 279..356 CDD:278578 20/76 (26%)
mfrnNP_651600.1 Mito_carr 13..98 CDD:278578 25/95 (26%)
PTZ00168 17..280 CDD:185494 74/283 (26%)
Mito_carr 107..190 CDD:278578 18/84 (21%)
Mito_carr <215..282 CDD:278578 19/72 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441246
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.