DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and CG4743

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_651415.1 Gene:CG4743 / 43101 FlyBaseID:FBgn0039357 Length:297 Species:Drosophila melanogaster


Alignment Length:307 Identity:72/307 - (23%)
Similarity:136/307 - (44%) Gaps:37/307 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GVVLVPATTVTPMRQKIDQVVI--SLISGAAAGALAKTVIAPLDRTKINFQIRNDVPFSFRASLR 115
            |:.....:....|::.::::..  :|::|..||.:....:.|:|..|...|  :::.| :||.  
  Fly     6 GLESAAGSVAIKMQEPVNKLKFFHALVAGGVAGMVVDIALFPIDTVKTRLQ--SELGF-WRAG-- 65

  Fly   116 YLQNTYANEGVLALWRGNSATMARIVPYAAIQFTAHEQWRRILHVDKDGTNTKGRRFL---AGSL 177
                     |...:::|.:...|...|.||:.|..:|..::.|   ...|.||...::   |.|.
  Fly    66 ---------GFRGIYKGLAPAAAGSAPTAALFFCTYECGKQFL---SSVTQTKDSPYVHMAAASA 118

  Fly   178 AGITSQSLTYPLDLARARMAVT--DRYTGYRTLRQVFTKIWVEEG-PRTLFRGYWATVLGVIPYA 239
            |.:.:..:..|:::|:.|....  ::.:|.    |:..:.:..|| .|.|:||:.:|::..||::
  Fly   119 AEVLACLIRVPVEIAKQRSQTLQGNKQSGL----QILLRAYRTEGLKRGLYRGFGSTIMREIPFS 179

  Fly   240 GTSFFTYETLKREYYEVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGDR 304
            ...|..:|..|.::..:.|.:.....|:|. ||.||......:.|||:|:.|:  |.......:|
  Fly   180 LIQFPLWEYFKLQWTPLTGFDSTPFSVALC-GAVAGGISAGLTTPLDVVKTRI--MLAERESLNR 241

  Fly   305 YPTILETLVKIYREEGVKNGFYKGL--SMNWIKGPIAVGISFSTYDL 349
            ..:....|..||.|.|. :|.:.|.  .:.||  .:.....|..|||
  Fly   242 RRSARRILHGIYLERGF-SGLFAGFVPRVLWI--TLGGAFFFGFYDL 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 19/88 (22%)
Mito_carr 169..251 CDD:278578 19/87 (22%)
Mito_carr 279..356 CDD:278578 20/73 (27%)
CG4743NP_651415.1 Mito_carr 23..99 CDD:278578 19/89 (21%)
PTZ00168 25..281 CDD:185494 66/282 (23%)
Mito_carr 199..291 CDD:278578 26/93 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441986
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.