DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and GC1

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001262490.1 Gene:GC1 / 41448 FlyBaseID:FBgn0260743 Length:321 Species:Drosophila melanogaster


Alignment Length:313 Identity:83/313 - (26%)
Similarity:139/313 - (44%) Gaps:30/313 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 ATTVTPMRQKIDQ---VVISLISGAAAGALAKTVIAPLDRTKI---NFQIRNDVPFSFRASLRYL 117
            ||..||:.|...|   ::..:|:|..||.:..|.:.|||..|.   |.||..:....:.:.....
  Fly     5 ATIATPLPQPQHQQFALLPKIINGGIAGIIGVTCVFPLDLVKTRLQNQQIGPNGERMYNSMFDCF 69

  Fly   118 QNTYANEGVLALWRGNSATMARIVPYAAIQFTAHEQWRRILHVDKDGTNTKGRRFLAGSLAGITS 182
            :.||..||...::||:...:..|.|..||:.||::.:|..| ..|||......:.:||.|||...
  Fly    70 RKTYKAEGYFGMYRGSGVNILLITPEKAIKLTANDYFRHKL-TTKDGKLPLTSQMVAGGLAGAFQ 133

  Fly   183 QSLTYPLDLARARMAVTDRYTGYRTL----------RQVFTKIWVEEGPRTLFRGYWATVLGVIP 237
            ..:|.|::|.:.:|....|......|          .|:.:::..::|...|::|..||.|..:.
  Fly   134 IIVTTPMELLKIQMQDAGRVAAAAKLAGKTVEKVSATQLASQLIKDKGIFGLYKGIGATGLRDVT 198

  Fly   238 YAGTSFFTYETL-----KREYYEVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRV 297
            ::...|..:.||     :|.    .|:.:.....|...|.|||:....|..|.|:|:.|:|.  :
  Fly   199 FSIIYFPLFATLNDLGPRRN----DGSGEAVFWCSFLAGLAAGSTAALAVNPFDVVKTRLQA--I 257

  Fly   298 NTAGGDR-YPTILETLVKIYREEGVKNGFYKGLSMNWIKGPIAVGISFSTYDL 349
            ..|.|:: :..|.:.:.|..:.||....|..||....:..|: .||:.:.|.|
  Fly   258 KKADGEKEFKGISDCITKTLKHEGPTAFFKGGLCRMIVIAPL-FGIAQTVYYL 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 25/89 (28%)
Mito_carr 169..251 CDD:278578 21/96 (22%)
Mito_carr 279..356 CDD:278578 20/72 (28%)
GC1NP_001262490.1 Mito_carr 36..113 CDD:278578 22/77 (29%)
Mito_carr 115..213 CDD:278578 22/97 (23%)
Mito_carr 226..307 CDD:278578 23/83 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442082
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.