DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and CG16736

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_649873.1 Gene:CG16736 / 41101 FlyBaseID:FBgn0037668 Length:277 Species:Drosophila melanogaster


Alignment Length:199 Identity:49/199 - (24%)
Similarity:82/199 - (41%) Gaps:20/199 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 MRQKIDQVVISLISGAAAGALAK-----TVIAPLDRTKINFQIRNDVPFSFRASLRYLQNTYANE 124
            |.|..:..::..|:|...|.||.     .||...|.|:.:::.||     :|...|.|:..||..
  Fly    87 MLQPYNTSMVLGITGFWGGVLATPFAKLAVIRQADLTRGSYERRN-----YRNFWRGLKCMYAKG 146

  Fly   125 GVLAL---WRGNS-ATMARIVPYAAIQFTAHEQWRRILHVDKDGTNTKGRRFLAGSLAGITSQSL 185
            |...|   |:.|| ::.|..|.|..|....|........:|:...:......|.||:..:    :
  Fly   147 GFTYLFTGWKINSISSTAVAVLYTPISDKVHTVISWFHRLDEPWLSDLITMALTGSIITV----I 207

  Fly   186 TYPLD-LARARMAVTDRYTGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETL 249
            ..|:| ||...:..:..| |..:...::.||..:.|.:..|.|:...::.:||:...:.|.|..|
  Fly   208 MTPVDALATLTLNESSHY-GRTSYPYLYRKIIRKHGYKGFFFGWKPALMALIPHTVLATFVYRFL 271

  Fly   250 KREY 253
            ...|
  Fly   272 LDRY 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 26/95 (27%)
Mito_carr 169..251 CDD:278578 19/82 (23%)
Mito_carr 279..356 CDD:278578
CG16736NP_649873.1 Mito_carr 6..81 CDD:278578
Mito_carr 187..277 CDD:278578 21/94 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441934
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.