DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and CG2616

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001287212.1 Gene:CG2616 / 40915 FlyBaseID:FBgn0037512 Length:449 Species:Drosophila melanogaster


Alignment Length:404 Identity:103/404 - (25%)
Similarity:161/404 - (39%) Gaps:90/404 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 TGSQLSSTMTTASATL----SSDLDDADTSRTQLSPSETSGVVLV--PATTVTPMRQKIDQVVIS 75
            ||....|..|:....|    |:..|||   ..:|:.|::|...|:  |...:.|::|     |||
  Fly    40 TGGSGGSGGTSGGNNLKPERSAREDDA---INRLTDSKSSHRKLLSDPRFQIRPLQQ-----VIS 96

  Fly    76 LISGAAAGALAKTVIAPLDRTKINFQIRN--------------DVPF------SFRASLRY---- 116
            ..:||...|...|   |||..|...|.:.              |..|      |..||||.    
  Fly    97 ACTGAMITACFMT---PLDVIKTRMQSQQSPAHKCFFYSNGLMDHLFASGPNGSELASLRQRPQF 158

  Fly   117 ------LQNTYANEGVLALWRGNSATMARIVPYAAIQFTAHEQWR-RILHVDKDGTN-------- 166
                  |.....:||:.|||.|...|:...:|...|.|.|:||:: |.|.:.:...|        
  Fly   159 SSSWDALMKISRHEGLAALWSGLGPTLVSALPSTIIYFVAYEQFKARYLQIYESHYNKSQEPRHL 223

  Fly   167 ----TKGR-----RFLAGSLAGITSQSLTYPLDLARARMAVTDRYTGYRTLRQVFTKIWVEEGPR 222
                ||..     ..::|..|.|.:.::..|::|.|.:|. ..|.| |..:.|....:...:|..
  Fly   224 EIRDTKKSLPSVVPMMSGVTARICAVTVVSPIELVRTKMQ-AQRQT-YAQMLQFVRSVVALQGVW 286

  Fly   223 TLFRGYWATVLGVIPYAGTSFFTYETLKREYYEVVGN-NKPNTLVSLAFGAAAGAAGQTASYPLD 286
            .|:||...|:|..:|::|..:..||:||:.    :|: ::|:..:|...|..||......:.|.|
  Fly   287 GLWRGLRPTILRDVPFSGIYWPIYESLKQN----LGHGSQPSFSLSFLAGVMAGTVAAIVTTPFD 347

  Fly   287 IVRRRMQTMRVNTAGGDRY------------PTILETLVKIYREEGVKNGFYKGLSMNWIKGPIA 339
            :|:...|     ...|:|.            .:....|..|||..||: |.:.|.....:|...|
  Fly   348 VVKTHEQ-----IEFGERVIFTDSPARDFGKKSTFSRLTGIYRTHGVR-GLFAGCGPRLLKVAPA 406

  Fly   340 VGISFSTYDLIKAW 353
            ..|..||::..|::
  Fly   407 CAIMISTFEYSKSF 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 34/117 (29%)
Mito_carr 169..251 CDD:278578 22/86 (26%)
Mito_carr 279..356 CDD:278578 20/87 (23%)
CG2616NP_001287212.1 Mito_carr 86..207 CDD:278578 36/128 (28%)
Mito_carr 230..321 CDD:278578 24/96 (25%)
Mito_carr 321..425 CDD:278578 25/106 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441498
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.