DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and slc25a19

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_991278.1 Gene:slc25a19 / 403024 ZFINID:ZDB-GENE-050417-292 Length:313 Species:Danio rerio


Alignment Length:319 Identity:92/319 - (28%)
Similarity:152/319 - (47%) Gaps:36/319 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 PATTVTPMRQKIDQVVISLISGAAAGALAKTVIAPLDRTKINFQIRNDVPFSFRASLRYLQNTY- 121
            |:.::.|..        :.::|:|||.:.:.:|:|||..||.||::.:     :.|.|..|..| 
Zfish     9 PSVSLAPEE--------AALAGSAAGIVTRALISPLDVVKIRFQLQIE-----KVSWRSRQGKYW 60

  Fly   122 ----------ANEGVLALWRGNSATMARIVPYAAIQFTAHEQWRRILHVDKD-GTNTKGRRFLAG 175
                      ..||:.|.|:|:.......|.|.|:||.:.|....::|.... .:.|.|..|:.|
Zfish    61 GLWQATRCILTEEGLPAFWKGHIPAQLLSVCYGAVQFASFEVLTELVHKKTPYNSQTAGVHFICG 125

  Fly   176 SLAGITSQSLTYPLDLARARMAVTDRYTGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAG 240
            .||..::.....|||..|.|.|.......||.||.....:....||.|.:||...|::.|.||||
Zfish   126 GLAACSATVACQPLDTLRTRFAAQGEPKIYRNLRHAIGTMLRSGGPFTFYRGLTPTLVAVFPYAG 190

  Fly   241 TSFFTYETLKR--EYYEVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQT-----MRVN 298
            ..||.|..||:  |:.:.......::|:|   |:.||...:|.:||.|::::|:|.     .|:.
Zfish   191 LQFFFYNILKKLLEHQDTKSKAGLHSLIS---GSCAGVISKTLTYPFDLIKKRLQVGGFEEARLK 252

  Fly   299 TAGGDRYPTILETLVKIYREEGVKNGFYKGLSMNWIKGPIAVGISFSTYDLIKAWLTEL 357
            ......|...::.:::|.||||.: ||:||||.:.:|..::.|.:|..|:...:.:..|
Zfish   253 FGEVRTYHGFVDCVLRIGREEGPR-GFFKGLSPSLLKAALSTGFTFFWYEFFISAIVSL 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 27/97 (28%)
Mito_carr 169..251 CDD:278578 30/81 (37%)
Mito_carr 279..356 CDD:278578 23/81 (28%)
slc25a19NP_991278.1 PTZ00169 20..290 CDD:240302 86/278 (31%)
Mito_carr 20..110 CDD:278578 28/94 (30%)
Mito_carr 117..203 CDD:278578 32/85 (38%)
Mito_carr 214..303 CDD:278578 28/92 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.