DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and Dic4

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001262021.1 Gene:Dic4 / 40039 FlyBaseID:FBgn0036808 Length:302 Species:Drosophila melanogaster


Alignment Length:286 Identity:71/286 - (24%)
Similarity:125/286 - (43%) Gaps:36/286 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GAAAGALAKTVIAPLDRTKINFQIRNDVPFSFRASLRYLQNTYANEGVLALWRGNSATMARIVPY 143
            |..|.......:||:|..|.:.||:...    |:.|..::..::.:|.|..:.|.||.:.|.:..
  Fly    26 GGFASMCVAFAVAPIDIVKTHMQIQRQK----RSILGTVKRIHSLKGYLGFYDGFSAAILRQMTS 86

  Fly   144 AAIQFTAHEQWRRILHVDKDGTNTKGRRFLAGSLAGITSQSLTYPLDLARARMAVTDRYTGY--R 206
            ..|.|..::..:::.:||:|....|   .:.|.:||....:...|.||...||....:...|  |
  Fly    87 TNIHFIVYDTGKKMEYVDRDSYLGK---IILGCVAGACGSAFGIPTDLINVRMQTDMKEPPYKRR 148

  Fly   207 TLRQVF---TKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFT------YETLKREYYEVVGNNKP 262
            ..:.||   .:|..|||.:.|::|      |.:....:|..|      |:.:|.   ||..|...
  Fly   149 NYKHVFDGLIRIPKEEGWKALYKG------GSVAVFKSSLSTCSQIAFYDIIKT---EVRKNISV 204

  Fly   263 NTLVSLAFGAAAGAA--GQTASYPLDIVRRRMQTMRVNTAGGDRYPTILETLVKIYREEGVKNGF 325
            |..:.|.|..:.|.:  ....::|||:||    |:.:|:..|: :.|:.:..|.:.| .||. |.
  Fly   205 NDGLPLHFLTSLGTSIISSAITHPLDVVR----TIMMNSRPGE-FRTVFQASVHMMR-FGVM-GP 262

  Fly   326 YKGLSMNWIKGPIAVGISFSTYDLIK 351
            |:|.....::...|..:.|..|:.::
  Fly   263 YRGFVPTIVRKAPATTLLFVLYEQLR 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 18/79 (23%)
Mito_carr 169..251 CDD:278578 22/92 (24%)
Mito_carr 279..356 CDD:278578 19/73 (26%)
Dic4NP_001262021.1 PTZ00169 26..288 CDD:240302 71/284 (25%)
Mito_carr 26..100 CDD:278578 18/77 (23%)
Mito_carr 104..201 CDD:278578 28/108 (26%)
Mito_carr 211..292 CDD:278578 21/85 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441931
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.