DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and CG18418

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_647924.2 Gene:CG18418 / 38572 FlyBaseID:FBgn0035568 Length:311 Species:Drosophila melanogaster


Alignment Length:266 Identity:66/266 - (24%)
Similarity:109/266 - (40%) Gaps:23/266 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 ISLISGAAAGALAKTVIAPLDRTKINFQIRNDV-PFSFRASLRYLQNTYANEGVLALWRGNSATM 137
            :..:.|..:|.||..::.|||..|...||...: ...::.|...|.....|||:|:|:.|.||.:
  Fly    16 MKFVMGGTSGMLATCIVQPLDLLKTRMQISGTLGTREYKNSFEVLSKVLKNEGILSLYNGLSAGL 80

  Fly   138 ARIVPYAAIQFTAHE---QWRRILHVDKDGTN--TKGRRFLAGSLAGITSQSLTYPLDLARARMA 197
            .|...|.:.:...::   .|.|     |:..|  :.......|.:||........|.::|..||.
  Fly    81 LRQATYTSAKMGVYQMELDWYR-----KNFGNYPSMVASMTMGIVAGAFGAMCGNPAEVALIRMM 140

  Fly   198 VTDRY-----TGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKREYYEVV 257
            ..:|.     ..|:.:...|.:|..:||...|:||...||...:........:|..:|.:.:..:
  Fly   141 SDNRLMPEDRRNYKNVGDAFVRIVKDEGVVALWRGCLPTVGRAMVVNMVQLASYSLMKNQLHGYL 205

  Fly   258 GNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGDRYPTILETLVKIYREEG-- 320
            ....|   :.|.....:|......|.|||:.:.|:|.|:| ..|...|...::.|.|:.:.||  
  Fly   206 SEGIP---LHLTAALVSGLLTSVTSMPLDMAKTRIQQMKV-IDGKPEYSGTIDVLKKVLKNEGAF 266

  Fly   321 -VKNGF 325
             |..||
  Fly   267 AVWKGF 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 24/88 (27%)
Mito_carr 169..251 CDD:278578 19/86 (22%)
Mito_carr 279..356 CDD:278578 17/50 (34%)
CG18418NP_647924.2 Mito_carr 10..108 CDD:278578 25/96 (26%)
PTZ00169 18..296 CDD:240302 66/264 (25%)
Mito_carr 109..205 CDD:278578 20/95 (21%)
Mito_carr 208..300 CDD:278578 20/69 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442049
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.