DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and Tpc2

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001246511.1 Gene:Tpc2 / 37983 FlyBaseID:FBgn0035078 Length:323 Species:Drosophila melanogaster


Alignment Length:335 Identity:94/335 - (28%)
Similarity:146/335 - (43%) Gaps:62/335 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 DQVVISL---ISGAAAGALAKTVIAPLDRTKINFQ-----IRNDVPFSFRASLRYLQNTYANEGV 126
            :.||:.|   :.|..|||..:|:..|||..||.||     :.|.....:|..:...::.||.||:
  Fly     4 NSVVVQLMQAVGGGIAGAATRTITQPLDVLKIRFQMQVEPVTNHKGSKYRGVIHAFKSVYAEEGM 68

  Fly   127 LALWRGNSATMARIVPYAAIQFTAHEQWRRILHVDKDGTNTKGRRFL----AGSLAGITSQSLTY 187
            ..::||:::.....:.||.:||.::||.|.:.|   .....:.|.||    .|.:||........
  Fly    69 RGMFRGHNSGQVLSISYALVQFWSYEQLRSMAH---QFDYWRERPFLMFFICGGIAGCLGAVAAQ 130

  Fly   188 PLDLARARMAVTD---------RYTGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSF 243
            |.|:.|.:|...|         .:||.|       |::..||...|.||...|::.|.|..|.:|
  Fly   131 PFDVVRTQMVAADPSSRRSQMNTFTGLR-------KVYKMEGWMGLSRGLPFTLVQVFPLVGANF 188

  Fly   244 FTYETLKR---------EYYEVVGNNKPNTLVSLAF----GAAAGAAGQTASYPLDIVRRRMQTM 295
            ..|:.|..         :..|:.|          ||    ||.:|...:...||.|::::|:|.|
  Fly   189 LFYKYLNAAVLMAKPPDQRQEIHG----------AFLFLNGALSGVLAKMIVYPADLLKKRIQLM 243

  Fly   296 -----RVNTAGGDRYPTILETLVKIYREEGVKNGFYKGLSMNWIKGPIAVGISFSTYDLIKAWLT 355
                 |.........||||..:...:||||: .|||||:....:|..:...:.||.||:.|... 
  Fly   244 AFKQERKTFGRNPECPTILGCITTTFREEGI-GGFYKGMLPTLLKAGLMSAVYFSIYDMFKRHY- 306

  Fly   356 ELANLRRVEK 365
             :|.::..||
  Fly   307 -IAPMKEAEK 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 30/94 (32%)
Mito_carr 169..251 CDD:278578 27/94 (29%)
Mito_carr 279..356 CDD:278578 26/81 (32%)
Tpc2NP_001246511.1 PTZ00169 23..304 CDD:240302 83/301 (28%)
Mito_carr 23..99 CDD:278578 23/75 (31%)
Mito_carr 108..194 CDD:278578 26/92 (28%)
Mito_carr 216..307 CDD:278578 29/93 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441607
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0752
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24089
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.