DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and CG18324

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_725361.1 Gene:CG18324 / 36568 FlyBaseID:FBgn0033905 Length:307 Species:Drosophila melanogaster


Alignment Length:290 Identity:64/290 - (22%)
Similarity:109/290 - (37%) Gaps:71/290 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 AAAGALAKTVIAPLDRTKINFQIRNDVPF--SFRASLRYLQNT----YANEGVLALWRGNSATMA 138
            ||.||:..|  .|:|..|...|::.::..  ::....|:|...    ..|:|:|||.:|      
  Fly    12 AAMGAVVFT--NPIDVVKTRMQLQGELAARGTYVKPYRHLPQAMLQIVLNDGLLALEKG------ 68

  Fly   139 RIVPYAAIQFTAH----EQWRRILHV----DKDGTNTKGRRFLAGSLAGITSQSLTYPLDLARAR 195
             :.|....||..:    ..:...|.:    :.||:.:..|....|:|.|.|......|..:.:|:
  Fly    69 -LAPALCYQFVLNSVRLSVYSNALELGYLQNADGSISFYRGMFFGALGGCTGTYFASPFYMIKAQ 132

  Fly   196 ---MAVTDRYTGYR----TLRQVFTKIWVEEGPRTLFRGYWATVL--------------GVIPYA 239
               .||.....|::    ::......|:...|    ..|:|...|              |..|.|
  Fly   133 QHAQAVQSIAVGFQHKHTSMMDALLHIYRTNG----ISGFWRAALPSLNRTLVASSVQIGTFPKA 193

  Fly   240 GT-----SFFTYETLKREYYEVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNT 299
            .:     .:.|:.                .|:|...|.::|.....|:.|.|::..||....|:.
  Fly   194 KSLLKDKGWITHP----------------VLLSFCAGLSSGTLVAVANSPFDVLTTRMYNQPVDE 242

  Fly   300 AG-GDRYPTILETLVKIYREEGVKNGFYKG 328
            .| |..|..:::...||:|.||: :|.|||
  Fly   243 KGRGLMYKGLVDCFTKIWRTEGI-HGMYKG 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 20/88 (23%)
Mito_carr 169..251 CDD:278578 19/107 (18%)
Mito_carr 279..356 CDD:278578 18/51 (35%)
CG18324NP_725361.1 Mito_carr 4..87 CDD:278578 20/83 (24%)
PTZ00169 5..293 CDD:240302 64/290 (22%)
Mito_carr 101..201 CDD:278578 19/103 (18%)
Mito_carr 204..296 CDD:278578 23/85 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441352
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.