DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and CG18327

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001260966.1 Gene:CG18327 / 36567 FlyBaseID:FBgn0033904 Length:304 Species:Drosophila melanogaster


Alignment Length:318 Identity:83/318 - (26%)
Similarity:131/318 - (41%) Gaps:60/318 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 ISGAAAGALAKTVIAPLDRTKINFQIRNDV--------PFS--FRASLRYLQNTYANEGVLALWR 131
            :.|..|...|.....|::..|...|::.::        |:.  |:|.:...:    |:|:|.|.:
  Fly     7 VLGGVAAMGAGVFTNPVEVIKTRIQLQGELAARGSHAQPYKSVFQAFVTVAK----NDGILGLQK 67

  Fly   132 GNSATMARIVPYAAIQFTAHEQWRRILH---VDKDGT-NTKGRRFLA-----GSLAGITSQSLTY 187
            |       :.|....||..: .:|..::   |:|... |.||....|     |:|.|:.......
  Fly    68 G-------LAPALCFQFVIN-SFRLSIYTHAVEKGWVHNNKGEISFAKGMFWGALGGVVGSYCAS 124

  Fly   188 PLDLARARM---AVTDRYTGYR----TLRQVFTKIWVEEGPRTLFRGYW-----ATVLGVIPYAG 240
            |..|.:.::   |......||:    ::.....||:.:.|...|:||..     |||...:..| 
  Fly   125 PFFLIKTQLQAQAAKQIAVGYQHQHASMSDAIRKIYRKNGVFGLWRGSLANVSRATVASAVQIA- 188

  Fly   241 TSFFTYETLKREYYEVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAG-GDR 304
             .|...::|.:|...|   ..| |::|...|.|||:....|..|||:|..|:....|:..| |..
  Fly   189 -VFGQAKSLLKENGVV---THP-TILSFCSGLAAGSFVSLAITPLDVVTTRLYNQGVDAQGRGIY 248

  Fly   305 YPTILETLVKIYREEGVKNGFYKGLSMNWIKGPIAV-GISFSTYDLIKAWLTELANLR 361
            |...|:.::.|.|.||| .|.|||.   |   ||.: ...:||  |:..:..||..||
  Fly   249 YRGWLDCVLTILRSEGV-YGLYKGF---W---PIYLRSAPYST--LVLLFFDELIALR 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 18/91 (20%)
Mito_carr 169..251 CDD:278578 22/98 (22%)
Mito_carr 279..356 CDD:278578 26/78 (33%)
CG18327NP_001260966.1 Mito_carr 4..87 CDD:278578 18/91 (20%)
PTZ00169 5..293 CDD:240302 79/312 (25%)
Mito_carr 101..201 CDD:278578 23/101 (23%)
Mito_carr 204..296 CDD:278578 35/101 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441350
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.