DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and CG8323

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_610933.1 Gene:CG8323 / 36566 FlyBaseID:FBgn0033903 Length:303 Species:Drosophila melanogaster


Alignment Length:292 Identity:69/292 - (23%)
Similarity:118/292 - (40%) Gaps:53/292 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 ISGAAAGALAKTVIAPLDRTKINFQIRNDVPF--SFRASLRYLQNTY----ANEGVLALWRGNSA 135
            :.|..|...|.....|::..|...|::.::..  ::....:.:.|.:    .|:|:..|.:|   
  Fly     7 VLGGLASVGATFFTNPIEVIKTRIQLQGELAARGTYVEPYKGIVNAFITVAKNDGITGLQKG--- 68

  Fly   136 TMARIVPYAAIQFT---------AHEQWRRILHVDKDGTNTKGRRFLAGSLAGITSQSLTYPLDL 191
                :.|....||.         :....||.:| ::.|..:.|...|.|::.|:.....:.|..|
  Fly    69 ----LAPALYFQFIINSFRLSIYSEAMERRWMH-NRKGEVSYGMGLLWGAIGGVVGCYFSSPFFL 128

  Fly   192 ARARM---AVTDRYTGYR--------TLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYA----GT 241
            .:.::   |......||:        .|||::::..|        ||.|...:..:|.|    |.
  Fly   129 IKTQLQSQAAKQIAVGYQHAHTSMTDALRQIYSRNGV--------RGLWRGSVAALPRAALGSGA 185

  Fly   242 SFFTYETLKR--EYYEVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAG-GD 303
            ...|:...|.  ..|::|  .:| ||.|.:.|..||:....|..|.|::..|:....|:..| |.
  Fly   186 QIATFGKTKALLVQYDLV--TQP-TLNSFSAGLIAGSIMSVAITPPDVITTRLYNQGVDAEGRGL 247

  Fly   304 RYPTILETLVKIYREEGVKNGFYKGLSMNWIK 335
            .|...|:..|||.|.||| .|.|||...|:::
  Fly   248 LYRGWLDCFVKILRSEGV-YGMYKGFWANYLR 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 16/96 (17%)
Mito_carr 169..251 CDD:278578 20/96 (21%)
Mito_carr 279..356 CDD:278578 21/58 (36%)
CG8323NP_610933.1 Mito_carr 4..87 CDD:278578 14/86 (16%)
PTZ00169 5..293 CDD:240302 69/292 (24%)
Mito_carr 101..200 CDD:278578 22/106 (21%)
Mito_carr 206..301 CDD:278578 28/75 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441351
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.