DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and CG8026

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_724769.2 Gene:CG8026 / 35941 FlyBaseID:FBgn0033391 Length:322 Species:Drosophila melanogaster


Alignment Length:305 Identity:84/305 - (27%)
Similarity:139/305 - (45%) Gaps:32/305 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LISGAAAGALAKTVIAPLDRTKINFQIRND-----VPFSFRASLRYLQNTYANEGVLALWRGNSA 135
            |::|.:.|.::..::.|||..||.|.: ||     || .:|.........:..||...|::|.:.
  Fly    26 LVAGVSGGVVSTLILHPLDLIKIRFAV-NDGRTATVP-QYRGLSSAFTTIFRQEGFRGLYKGVTP 88

  Fly   136 TMARIVPYAAIQFTAHEQWRRILHVDKDGTNT-----KGRRFLAGSLAGITSQSLTYPLDLARAR 195
            .:........:.|..:...:..:    .|.||     .....||.:.:||.:..||.|:.:.:.|
  Fly    89 NVWGSGSSWGLYFMFYNTIKTFI----QGGNTTMPLGPTMNMLAAAESGILTLLLTNPIWVVKTR 149

  Fly   196 MAV-TDRYTG--YRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLK---REYY 254
            :.: .|..:.  ||.:.....:|:.|||.|.|:||:...:||| .:....|.|||.||   .||.
  Fly   150 LCLQCDAASSAEYRGMIHALGQIYKEEGIRGLYRGFVPGMLGV-SHGAIQFMTYEELKNAYNEYR 213

  Fly   255 EVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGDRYPTILETLVKIYREE 319
            ::..:.|..|...|||.|.:......|:||..:||.|:|...      .||....:.:.:.:|.|
  Fly   214 KLPIDTKLATTEYLAFAAVSKLIAAAATYPYQVVRARLQDHH------HRYNGTWDCIKQTWRFE 272

  Fly   320 GVKNGFYKGLSMNWIKGPIAVGISFSTYDLIKAWLTELANLRRVE 364
            |.: ||||||..:..:...|..::|..|:.:..:|  ||..:|:|
  Fly   273 GYR-GFYKGLKASLTRVVPACMVTFLVYENVSHFL--LARRKRIE 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 19/87 (22%)
Mito_carr 169..251 CDD:278578 28/87 (32%)
Mito_carr 279..356 CDD:278578 22/76 (29%)
CG8026NP_724769.2 PTZ00169 13..287 CDD:240302 76/274 (28%)
Mito_carr 23..115 CDD:278578 20/94 (21%)
Mito_carr 119..213 CDD:278578 29/94 (31%)
Mito_carr 220..307 CDD:278578 28/95 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441787
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.