DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and Dic3

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_610344.2 Gene:Dic3 / 35763 FlyBaseID:FBgn0033248 Length:287 Species:Drosophila melanogaster


Alignment Length:313 Identity:68/313 - (21%)
Similarity:113/313 - (36%) Gaps:78/313 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 GAAAGALAKTVIAPLDRTKINFQIRNDVPFSFRASL-RYLQNTYANEGVLALWRGNSATMARIVP 142
            |....|:|.|...|:|..|:..|.::...   |.:: ..|:..:...|:|..:.|.||:..|.:.
  Fly    15 GGVCAAIAVTGTHPIDLIKVQLQTQSQAD---RKTVGEILKGIHERSGILGFYNGISASWFRQLT 76

  Fly   143 YAAIQFTAHEQWRRILHVDKDGTNTK--GRRFLAGSLAGITSQSLTYPLDLARARM-----AVTD 200
            |...:|..:|       ..||..:|:  ..:....:.|||....:..|.|:...|:     ...:
  Fly    77 YTTTRFALYE-------AGKDYVDTQKVSSKMALATFAGIVGGIVGVPGDVVTVRLQNDVKLPEE 134

  Fly   201 RYTGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKREYYEVVGNN----K 261
            :...|:.:.....:|:.|||..:||||                 |...:.|.....:|.|    :
  Fly   135 KRRNYKHVFDGLFRIYKEEGVSSLFRG-----------------TVPAVSRAVLLTIGTNAAYDQ 182

  Fly   262 PNTLVSLAFGAA------------AGAAGQTASYPLDIVR---RRMQTMRVNTAGGDRYPTILET 311
            ...::.:|.||.            ||......:.|||:::   ...|....:..||    ..|.|
  Fly   183 VKQMLKIATGAGEGVPLHFATSTIAGCIAVVITQPLDVIKTTFMNAQPGEFSGIGG----AFLST 243

  Fly   312 LVKIYREEGVKNG---FYKGLSMNWIKGPIAVGISFSTYDLIKAWLTELANLR 361
                     .|.|   ||||..      |..:.:|.:|  :|...|.|.|.:|
  Fly   244 ---------AKQGPLAFYKGFI------PALIRVSPNT--IITFVLYEQARMR 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 19/80 (24%)
Mito_carr 169..251 CDD:278578 16/86 (19%)
Mito_carr 279..356 CDD:278578 19/82 (23%)
Dic3NP_610344.2 PTZ00169 15..275 CDD:240302 65/307 (21%)
Mito_carr 15..91 CDD:278578 20/85 (24%)
Mito_carr 93..187 CDD:278578 20/110 (18%)
Mito_carr 200..281 CDD:278578 24/101 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441933
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.