DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and CG4995

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_609380.1 Gene:CG4995 / 34390 FlyBaseID:FBgn0032219 Length:399 Species:Drosophila melanogaster


Alignment Length:334 Identity:81/334 - (24%)
Similarity:149/334 - (44%) Gaps:39/334 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 DDADTSRTQLSPSETSGVVL-VPATTVTPMRQKIDQVVISLISGAAAGALAKTVIAPLDRTKINF 100
            :|.|..|.:  .||...:.| ..:.|.:|      ::|:..::|...||....|..|.|..|::.
  Fly    12 NDKDPYRKR--GSEIGDIQLKATSETFSP------KMVVDFVAGLLGGAAGVLVGHPFDTVKVHL 68

  Fly   101 QIRNDVPFSFRASLRYLQNTYANEGVLALWRGNSATMARIVPYAAIQFTAHEQWRRILHVDKDGT 165
            |..:.....::.:....:.....:..:.|:||.|:.|..|....||.|..:...:|:    .:..
  Fly    69 QTDDPRNPKYKGTFHCFRTIVQRDKFIGLYRGISSPMGGIGLVNAIVFGVYGNVQRL----SNDP 129

  Fly   166 NTKGRRFLAGSLAGITSQSLTYPLDLARARMAVTD------RYTGYRTLRQVFTKIWVEEGPRTL 224
            |:....|.|||:||:....:..|::||:.|:.::.      ::||.....:...|   .||.|..
  Fly   130 NSLTSHFFAGSIAGVAQGFVCAPMELAKTRLQLSTQVDSGIKFTGPIHCLKYIVK---TEGIRGA 191

  Fly   225 FRGYWATVLGVIPYAGTSFFTYETLKREYYEVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVR 289
            |:|..||:|..||...:.|.::|.|.|:.      ..|....:|..|..||.:...|.||:|:|:
  Fly   192 FKGLTATILRDIPGFASYFVSFEYLMRQV------ETPGVAYTLMAGGCAGMSSWLACYPIDVVK 250

  Fly   290 RRMQTMRVNTAGGD-RYPTILETLVKIYREEGVKNGFYKGLSMNWIKG-PIAVGISFSTYDLIKA 352
            ..||   .:..|.: :|...::..:|.:|.||.:. |::||:...|:. |:.....|     :.:
  Fly   251 THMQ---ADALGANAKYNGFIDCAMKGFRNEGPQY-FFRGLNSTLIRAFPMNAACFF-----VVS 306

  Fly   353 WLTELANLR 361
            |:.::.|.:
  Fly   307 WVLDICNAK 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 19/86 (22%)
Mito_carr 169..251 CDD:278578 26/87 (30%)
Mito_carr 279..356 CDD:278578 20/78 (26%)
CG4995NP_609380.1 Mito_carr 36..125 CDD:278578 19/94 (20%)
PTZ00169 41..295 CDD:240302 69/270 (26%)
Mito_carr 128..218 CDD:278578 27/92 (29%)
Mito_carr 221..304 CDD:278578 24/91 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441405
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.