DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and CG9582

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001285773.1 Gene:CG9582 / 34230 FlyBaseID:FBgn0032090 Length:300 Species:Drosophila melanogaster


Alignment Length:313 Identity:71/313 - (22%)
Similarity:119/313 - (38%) Gaps:74/313 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 MRQKIDQVVISL-----ISGAAAGALAKTVIAPLDRTKINFQIRNDVPFS----FRASLRYLQNT 120
            |..:.::.|.||     ::|..:|.:......|||..|...||:...||.    :...|..:...
  Fly     1 MATRSEETVRSLAHWQFLAGGLSGFIEIICFHPLDVVKTRMQIQGAHPFGGEVVYTCPLDAIVKI 65

  Fly   121 YANEGVLALWRGNSATMARIVPYAAIQFTAHEQWRRILHVDKDGTNTKGRRFL------------ 173
            |..||:.:||:|       |||...::                 |..:|.:||            
  Fly    66 YRYEGLSSLWKG-------IVPPICVE-----------------TPKRGGKFLMYESLKPYFQFG 106

  Fly   174 -----------AGSLAGITSQSLTYPLDLARARMAVTDR-YTGYRTLRQVFTKIWVEE---GPRT 223
                       :||:|.|....|..|.::.:    :|.: :.|.|.......|..::.   |.:.
  Fly   107 APQPTPLTHAMSGSMAAILESFLVNPFEVVK----ITQQAHRGKRLKTLSVVKYIIKHDGYGIKG 167

  Fly   224 LFRGYWATVLGVIPYAGTSFFTYETLKREYYEVVGNNKPNTLVSLAFGAAAGAAGQTA---SYPL 285
            |:||..|.|.....:....|..|..||    ::|.:.:..|...|.....||.|...|   |..|
  Fly   168 LYRGITALVARNAVFHFGFFGFYNALK----DIVPSPEDKTYNILRKVIIAGLASSLACVMSVTL 228

  Fly   286 DIVRRRMQTMRVNTAGGDRYPTILETLVKIYREEGVKNGFYKGLSMNWIK-GP 337
            |:.:.|:|..: ...|..:|...:.|:...::|||.:: .:|||....:: ||
  Fly   229 DMAKCRIQGPQ-PVKGEVKYQWTISTIKSTFKEEGFRS-LFKGLGAMILRVGP 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 23/95 (24%)
Mito_carr 169..251 CDD:278578 22/108 (20%)
Mito_carr 279..356 CDD:278578 17/63 (27%)
CG9582NP_001285773.1 PTZ00169 17..296 CDD:240302 67/297 (23%)
Mito_carr 17..104 CDD:278578 24/110 (22%)
Mito_carr 109..196 CDD:278578 20/94 (21%)
Mito_carr 216..295 CDD:278578 18/66 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442101
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.