DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and colt

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_477221.1 Gene:colt / 33470 FlyBaseID:FBgn0019830 Length:306 Species:Drosophila melanogaster


Alignment Length:283 Identity:69/283 - (24%)
Similarity:120/283 - (42%) Gaps:22/283 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 TTVTPMRQKIDQVVISLISGAAAGALAKTVIAPLDRTKINFQIR-----NDVPFSFRASLRYLQN 119
            ||.....::....|.|.::|...|........|||..|:..|..     .:.|. :|.:......
  Fly     3 TTENVSTERKANPVKSFLTGGFGGICNVLSGHPLDTIKVRLQTMPRPAPGEQPL-YRGTFDCAAK 66

  Fly   120 TYANEGVLALWRGNSATMARIVPYAAIQFTAHEQWRRILHVDKDGTNTKGRRFLAGSLAGITSQS 184
            |..||||..|::|.||.:..:.|..|:.|..:...:|:....:|...|..:.|:|||.:|:.|..
  Fly    67 TIKNEGVRGLYKGMSAPLTGVAPIFAMCFAGYALGKRLQQRGEDAKLTYPQIFVAGSFSGLFSTL 131

  Fly   185 LTYPLDLARARMAVTDRYTG---YRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTY 246
            :..|.:..:..:.......|   |..:.....|::.|.|.|::|:|..||:|..:|..|..|..|
  Fly   132 IMAPGERIKVLLQTQQGQGGERKYNGMIDCAGKLYKEGGLRSVFKGSCATMLRDLPANGLYFLVY 196

  Fly   247 ETLKREYYEVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNT-AGGDRYPTILE 310
            |.|:..........:.:|..::..|..||.|......|.|:::.|:|:....| ..|.|      
  Fly   197 EALQDVAKSKSETGQISTASTIFAGGVAGMAYWILGMPADVLKSRLQSAPEGTYKHGIR------ 255

  Fly   311 TLVKIYREEGVKNG---FYKGLS 330
               .::::..||:|   .|:|::
  Fly   256 ---SVFKDLIVKDGPLALYRGVT 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 24/91 (26%)
Mito_carr 169..251 CDD:278578 24/84 (29%)
Mito_carr 279..356 CDD:278578 12/56 (21%)
coltNP_477221.1 Mito_carr 12..107 CDD:395101 24/95 (25%)
Mito_carr 112..202 CDD:395101 25/89 (28%)
Mito_carr 210..299 CDD:395101 17/75 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441752
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.