DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and Rim2

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_608615.1 Gene:Rim2 / 33350 FlyBaseID:FBgn0031359 Length:365 Species:Drosophila melanogaster


Alignment Length:368 Identity:76/368 - (20%)
Similarity:136/368 - (36%) Gaps:85/368 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 MRQKIDQVVISLISGAAAGALAKTVIAPLDRTKINFQ---------------------------- 101
            |.|.....:|.||:|.:||.:...|..||:..|...|                            
  Fly     1 MAQNTADTLIHLIAGGSAGTVGAVVTCPLEVVKTRLQSSTAFMTPSRLAENAGGGPANGGQSELL 65

  Fly   102 -----------------------------------IRNDVPFSFRASLRYLQNTYANEGVLALWR 131
                                               |.:..|.|. :.::.|::...|||..||::
  Fly    66 RPEQRRKLSTTILRNRSQPQVIGGVRRIMAISHCGISSTTPKSM-SIVQCLRHIVQNEGPRALFK 129

  Fly   132 GNSATMARIVPYAAIQFTAHEQWRRILH----VDKDGTNTKGRRFLAGSLAGITSQSLTYPLDLA 192
            |....:..:.|..||.|..:.|.:..|:    |::|....   ..::.:.||..|.:.|.|:...
  Fly   130 GLGPNLVGVAPSRAIYFCTYSQTKNTLNSLGFVERDSPLV---HIMSAASAGFVSSTATNPIWFV 191

  Fly   193 RARMAVTDRYTGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKREYYEVV 257
            :.||.:........|:||...:::.:.|....::|..|:..|:.. ....|..||.:|.:..|..
  Fly   192 KTRMQLDYNSKVQMTVRQCIERVYAQGGVAAFYKGITASYFGICE-TMVHFVIYEFIKSKLLEQR 255

  Fly   258 GNNKPNTLVSLAF------GAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGDRYPTILETLVKIY 316
            .....:|..|..|      ||.:.......:||.::.|.|::      ..|::|.:..:||..::
  Fly   256 NQRHTDTKGSRDFLEFMMAGAVSKTIASCIAYPHEVARTRLR------EEGNKYNSFWQTLHTVW 314

  Fly   317 REEGVKNGFYKGLSMNWIKGPIAVGISFSTYDLIKAWLTELAN 359
            :||| :.|.|:||:...::......|..:||:.:...||...|
  Fly   315 KEEG-RAGLYRGLATQLVRQIPNTAIMMATYEAVVYVLTRRFN 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 26/149 (17%)
Mito_carr 169..251 CDD:278578 17/81 (21%)
Mito_carr 279..356 CDD:278578 19/76 (25%)
Rim2NP_608615.1 Mito_carr 8..156 CDD:278578 26/148 (18%)
Mito_carr 163..253 CDD:278578 19/93 (20%)
Mito_carr 268..355 CDD:278578 23/93 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442104
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.