DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and CG1628

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_572639.2 Gene:CG1628 / 31990 FlyBaseID:FBgn0030218 Length:459 Species:Drosophila melanogaster


Alignment Length:307 Identity:79/307 - (25%)
Similarity:127/307 - (41%) Gaps:44/307 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 VISLISGAAAGALAKTVIAPLDRTKINFQIRNDVPFSFRASLRYLQNTYANEGVL-ALWRGNSAT 136
            :|..::|:..||....|..|||..|:..|   ..|.::|..|....:||..:||| .|:.|:...
  Fly   170 LIDFLAGSLGGAAQVYVSQPLDTVKVKLQ---TFPEAYRGMLDCFLSTYRKDGVLRGLYAGSVPA 231

  Fly   137 MARIVPYAAIQFTAHEQWRRILH--VDKD--GTNTKGRRFLAGSLAGITSQSLTYPLDLARARMA 197
            :...|...::.|.|:...::.:.  |.|:  |..|..:...|||||...|.....|.:|.:.::.
  Fly   232 VFANVAENSVLFAAYGGCQKFVAFCVGKETAGDLTTVQNACAGSLAACFSTLTLCPTELIKCKLQ 296

  Fly   198 VTDRYTGY---------RTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFF------TYE 247
            .......:         ||...:...||..||.|..:||..:|.|..:|  |..||      |.|
  Fly   297 ALREMKNFVEPAHPQDIRTPWTLTRYIWRTEGIRGFYRGLSSTFLREMP--GYFFFFGSYEGTRE 359

  Fly   248 TLKREYYEVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVN----TAGGDRYPTI 308
            .|:|:...........|:::   ||..|....|:::|.|:::.|:|...:|    ..|.|     
  Fly   360 LLRRDDQSKDDIGPLRTMIA---GAIGGVCLWTSTFPADVIKSRIQVKNLNESMFAVGAD----- 416

  Fly   309 LETLVKIYREEGVKNGFYKGLSMNWIKGPIAVGISFSTYDLIKAWLT 355
                  |.|.|||. ..|:||..:.::...|....|..|:..|..|:
  Fly   417 ------IVRREGVL-ALYRGLLPSVLRTIPATATLFVVYEYTKRALS 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 23/86 (27%)
Mito_carr 169..251 CDD:278578 26/96 (27%)
Mito_carr 279..356 CDD:278578 21/81 (26%)
CG1628NP_572639.2 PTZ00169 162..455 CDD:240302 78/304 (26%)
Mito_carr 170..252 CDD:278578 23/84 (27%)
Mito_carr 263..364 CDD:278578 28/102 (27%)
Mito_carr 369..455 CDD:278578 24/100 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441861
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.