DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and CG5254

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_569856.2 Gene:CG5254 / 31020 FlyBaseID:FBgn0040383 Length:306 Species:Drosophila melanogaster


Alignment Length:315 Identity:70/315 - (22%)
Similarity:123/315 - (39%) Gaps:61/315 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 QVVISLISGAAAGALAKTVIAPLDRTKINFQIRNDVPFSFRASLRYLQ---------NTYANEGV 126
            :....:::|.:||.|...::.|||..|...||: ..|....|:|..:.         ..|.:||:
  Fly    13 RAAFQVLAGGSAGFLEVCIMQPLDVVKTRIQIQ-ATPAPNAAALGEVHYNGVFDCFAKMYRHEGI 76

  Fly   127 LALWRGNSATMARIVPYAAIQFTAHEQWRRILHVDKDGTNTKGRRFLAGSLAGITSQSL----TY 187
            .:.|:|....:....|..||:|...||.:.:...   |:.|...  |..||||:|:.:|    ..
  Fly    77 SSYWKGIMPPILAETPKRAIKFLVFEQTKPLFQF---GSPTPTP--LTFSLAGLTAGTLEAIAVN 136

  Fly   188 PLDLAR-----------------ARMAVTDRYTGYRTLRQVFTKIWVEEGP-RTLFRGYWATVLG 234
            |.::.:                 |:..:.....|:..|.:..|......|. ..::.|::.:|..
  Fly   137 PFEVVKVAQQADRQKKMLSTFAVAKGIIQQDGLGFSGLNKGITATMGRNGVFNMVYFGFYHSVKN 201

  Fly   235 VIPYAGTSFFTYETLKREYYEVVGNNKPNTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTMRVNT 299
            |:|              ||.|    :....|..:..|..||......:.|.|:.:.|:|..: ..
  Fly   202 VVP--------------EYKE----SHLEFLRKVTIGFLAGTLACFVNIPFDVAKSRIQGPQ-PV 247

  Fly   300 AGGDRYPTILETLVKIYREEGVKNGFYKGLSMNWIK----GPIAVGISFSTYDLI 350
            .|..:|...|.::..:|||||.: ..||||....::    |.|.:.:...:||.:
  Fly   248 PGQIKYRGTLSSMGIVYREEGFR-ALYKGLVPKIMRLGPGGAILLLVFEYSYDYL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 24/95 (25%)
Mito_carr 169..251 CDD:278578 17/103 (17%)
Mito_carr 279..356 CDD:278578 20/76 (26%)
CG5254NP_569856.2 Mito_carr 18..112 CDD:278578 24/97 (25%)
PTZ00169 19..301 CDD:240302 70/307 (23%)
Mito_carr 122..207 CDD:278578 16/98 (16%)
Mito_carr 209..305 CDD:278578 24/95 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45442100
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.