DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and Slc25a19

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_001007675.1 Gene:Slc25a19 / 303676 RGDID:1359554 Length:318 Species:Rattus norvegicus


Alignment Length:287 Identity:81/287 - (28%)
Similarity:143/287 - (49%) Gaps:15/287 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 ISGAAAGALAKTVIAPLDRTKINFQIR------NDVPFSFRASLRYLQNTYANEGVLALWRGNSA 135
            ::|:.:|.:.:.:|:|||..||.||::      :|....:...|:..:.....||..|.|:|:..
  Rat    20 VAGSVSGFVTRALISPLDVIKIRFQLQLERVCPSDPNAKYHGILQAAKQILQEEGPRAFWKGHVP 84

  Fly   136 TMARIVPYAAIQFTAHEQWRRILH-VDKDGTNTKGRRFLAGSLAGITSQSLTYPLDLARARMAVT 199
            .....:.|.|:||.|.|:...:|: .:...|:.....|:.|.|:..|:....:|:|:.|.|:|..
  Rat    85 AQILSIGYGAVQFLAFEELTELLY
QANLYQTHQFSAHFVCGGLSAGTATLTVHPVDVLRTRLAAQ 149

  Fly   200 DRYTGYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKREYYEVV--GNNKP 262
            .....|..||:....::..|||...::|...||:.:.||||..|..|.:|||.|..::  ...:.
  Rat   150 GEPKIYSNLREAIRTMYRTEGPFVFYKGLTPTVIAIFPYAGLQFSCYRSLKRAYDWIMPPDGKQT 214

  Fly   263 NTLVSLAFGAAAGAAGQTASYPLDIVRRRMQTM---RVNTAGGD--RYPTILETLVKIYREEGVK 322
            ..|.:|..|..:|...:|.:||||:.::|:|..   ...:|.|.  .|..:|:...::.:.||.:
  Rat   215 GNLKNLLCGCGSGVISKTLTYPLDLFKKRLQVRGFEHARSAFGQVRSYRGLLDLAQQVLQHEGTR 279

  Fly   323 NGFYKGLSMNWIKGPIAVGISFSTYDL 349
             ||:||||.:.:|..::.|..|..|:|
  Rat   280 -GFFKGLSPSLMKAALSTGFMFFWYEL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 23/87 (26%)
Mito_carr 169..251 CDD:278578 25/81 (31%)
Mito_carr 279..356 CDD:278578 24/76 (32%)
Slc25a19NP_001007675.1 Mito_carr 16..108 CDD:278578 23/87 (26%)
Mito_carr 118..203 CDD:278578 27/84 (32%)
Mito_carr 212..311 CDD:278578 28/95 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0752
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.