DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and Slc25a43

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:XP_003752180.2 Gene:Slc25a43 / 298318 RGDID:1559928 Length:329 Species:Rattus norvegicus


Alignment Length:283 Identity:81/283 - (28%)
Similarity:136/283 - (48%) Gaps:26/283 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 AGALAKTVIAPLDRTKINFQIRNDVPFSFRASLRYLQNTYA-------NEGVLALWRGNSATMAR 139
            |||.:.::.|||:...:..|:......|        |..:|       :||..|||:||.....|
  Rat    22 AGAFSLSLTAPLELATVLAQVGRVQSHS--------QGLWATGRRVWLSEGPRALWKGNGVACLR 78

  Fly   140 IVPYAAIQFTAHEQWRRILHVDKDGTNTKGRRFLAGSLAGITSQSLTYPLDLARARMAVTDRY-T 203
            :.|.:.:|..|:.:: .:|.:|..|..::....:||||||:.|..:|||.||.:.|:.|.:.. .
  Rat    79 LFPCSVVQLAAYRKF-VVLFMDDL
GRISQWSSIVAGSLAGMVSTIVTYPTDLIKTRLIVQNMLEP 142

  Fly   204 GYRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKREYYEVVG-NNKPNTLVS 267
            .||.|....:.|:.:||...|:||...||||.:|::..|...|..|::.:   .| .::.:.|.:
  Rat   143 SYRGLIHALSTIYQQEGFLALYRGASLTVLGAVPFSAGSLLVYMNLEKIW---TGPRDRFSHLQN 204

  Fly   268 LAFGAAAGAAGQTASYPLDIVRRRMQTMR---VNTAGGD-RYPTILETLVKIYREEGVKNGFYKG 328
            .|....|.|..|..|:|.|.|:|:||...   .:..|.| .:...::...:|.:.:||. |.:.|
  Rat   205 FATVCVAAAVSQAVSFPFDTVKRKMQAQSPYLPHYGGVDIHFSGAVDCFRQIVKTQGVL-GLWNG 268

  Fly   329 LSMNWIKGPIAVGISFSTYDLIK 351
            |:.|.:|.....|:.|..::..|
  Rat   269 LTANLLKVVPYFGVMFGMFEFCK 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 21/83 (25%)
Mito_carr 169..251 CDD:278578 31/82 (38%)
Mito_carr 279..356 CDD:278578 21/77 (27%)
Slc25a43XP_003752180.2 Mito_carr 8..101 CDD:278578 23/87 (26%)
Mito_carr 102..185 CDD:278578 30/82 (37%)
Mito_carr 197..295 CDD:278578 25/96 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0752
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1253450at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.