DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment DPCoAC and SLC25A41

DIOPT Version :9

Sequence 1:NP_001287430.1 Gene:DPCoAC / 42429 FlyBaseID:FBgn0067783 Length:365 Species:Drosophila melanogaster
Sequence 2:NP_775908.2 Gene:SLC25A41 / 284427 HGNCID:28533 Length:370 Species:Homo sapiens


Alignment Length:282 Identity:105/282 - (37%)
Similarity:152/282 - (53%) Gaps:12/282 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 LISGAAAGALAKTVIAPLDRTKINFQIRNDVPFSFRASLRYLQNTYANEGVLALWRGNSATMARI 140
            |:|||.|||:::|..|||||.|:..|:.:. ..:|...|..||:.....|..:|||||...:.:|
Human    96 LLSGAMAGAVSRTGTAPLDRAKVYMQVYSS-KTNFTNLLGGLQSMVQEGGFRSLWRGNGINVLKI 159

  Fly   141 VPYAAIQFTAHEQWRRILHVDKDGTNTKGRRFLAGSLAGITSQSLTYPLDLARARMAVTDRYTG- 204
            .|..||:|:..||.:... ....|:.....|.||||||...||:|..|:::.:.|:  |.|.|| 
Human   160 APEYAIKFSVFEQCKNYF-CGIQGSPPFQERLLAGSLAVAISQTLINPMEVLKTRL--TLRRTGQ 221

  Fly   205 YRTLRQVFTKIWVEEGPRTLFRGYWATVLGVIPYAGTSFFTYETLKREYYEVVGNN--KPNTLVS 267
            |:.|.....:|...||.|.|:|||...:||:||||.|....||.|:. ::...|.:  .|:.|||
Human   222 YKGLLDCARQILQREGTRALYRGYLPNMLGIIPYACTDLAVYEMLQC-FWVKSGRDMGDPSGLVS 285

  Fly   268 LAFGAAAGAAGQTASYPLDIVRRRMQTMRVNTAGGDRYPTILETLVKIYREEGVKNGFYKGLSMN 332
            |:....:...||.|||||.:||.|||..  :|..|.. ||:...|.:|..::|.. |.|:|::..
Human   286 LSSVTLSTTCGQMASYPLTLVRTRMQAQ--DTVEGSN-PTMRGVLQRILAQQGWL-GLYRGMTPT 346

  Fly   333 WIKGPIAVGISFSTYDLIKAWL 354
            .:|...|.|||:..|:.:|..|
Human   347 LLKVLPAGGISYVVYEAMKKTL 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
DPCoACNP_001287430.1 Mito_carr 72..159 CDD:278578 32/82 (39%)
Mito_carr 169..251 CDD:278578 36/82 (44%)
Mito_carr 279..356 CDD:278578 29/76 (38%)
SLC25A41NP_775908.2 PTZ00169 87..368 CDD:240302 104/280 (37%)
Solcar 1. /evidence=ECO:0000255 90..176 32/80 (40%)
Mito_carr 92..177 CDD:278578 32/81 (40%)
Mito_carr 182..274 CDD:278578 37/94 (39%)
Solcar 2. /evidence=ECO:0000255 184..269 36/87 (41%)
Mito_carr 278..369 CDD:278578 35/95 (37%)
Solcar 3. /evidence=ECO:0000255 280..367 34/90 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54381
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.